The URL can be used to link to this page

_703443.04_Stormwater Management Report Stamped & Signed 2021.01.15 GLWA-SOQ-020 | 0 STORMWATER MANAGEMENT REPORT BIG Y KIOSK & GAS STATION, 136 N. KING STREET, NORTHAMPTON, MA Prepared for: Big Y 2145 Roosevelt Avenue PO Box 7840 Springfield, MA 01102 Prepared by: Alfred Benesch & Company 120 Hebron Avenue, Floor 2, Glastonbury, CT 06033 Submitted: January 2021 Copyright 2019, of Alfred Benesch & Company. All rights reserved. This plan and design content is the property of Alfred Benesch & Company. Use, reuse, reproduction or modification of this plan or design information, or any part thereof, is strictly prohibited, Big Y Kiosk and Gas Station | Stormwater Management Report | 1 1 PROJECT INFORMATION ............................................................................................................3 Applicant & Project .......................................................................................................................3 Project Address .............................................................................................................................3 Firm & Registered Professional Engineer ......................................................................................3 2 EXISTING CONDITIONS ..............................................................................................................3 Existing Uses ..................................................................................................................................3 Topography & Drainage ................................................................................................................3 Soils ...............................................................................................................................................4 3 PROPOSED CONDITIONS ...........................................................................................................4 Proposed Uses ...............................................................................................................................4 Point of Analysis ............................................................................................................................4 Topography & Drainage ................................................................................................................4 4 MA DEP STORMWATER MANAGEMENT STANDARDS .................................................................5 Standard 1: No New Untreated Discharges .................................................................................5 Standard 2: Peak Rate Attenuation ..............................................................................................5 Standard 3: Recharge to Groundwater ........................................................................................5 Standard 4: Water Quality ...........................................................................................................7 Standard 5: Land Uses with Higher Potential Pollutant Loads (HPPL) .........................................8 Standard 6: Critical Areas .............................................................................................................8 Standard 7: Redevelopment ........................................................................................................9 Standard 8: Construction Period Pollution and Erosion and Sedimentation Control ..................9 Standard 9: Operation and Maintenance (O&M) Plan ................................................................9 Standard 10: Prohibition of Illicit Discharges ............................................................................ 10 TABLE OF CONTENTS Big Y Kiosk and Gas Station | Stormwater Management Report | 2 LIST OF APPENDICES Appendix A MA – DEP Stormwater Checklist Appendix B Existing Condition Site Plan Proposed Conditions Site Plan Erosion and Sedimentation Control Plan Appendix C NRCS Soil Information Appendix D Pre- & Post-Development Drainage Calculations TSS Calculations Appendix E Stormwater System Long Term O&M Plan Appendix F Illicit Discharge Compliance Statement Appendix G NOAA Rainfall Data Big Y Kiosk and Gas Station | Stormwater Management Report | 3 1 PROJECT INFORMATION Applicant & Project Big Y Proposed Kiosk Gas Station Project Type: Redevelopment Project Address 136 North King Street Northampton, MA 01060 Firm & Registered Professional Engineer Alfred Benesch & Company 120 Hebron Avenue, Floor 2 Glastonbury, CT 06033 Ryan G. Scrittorale, PE License #: 53286 2 EXISTING CONDITIONS Existing Uses The property is approximately 0.50 acres and is situated at 136 North King Street in Northampton, Massachusetts. It lies directly west of North King Street. For purposes of this report, the “site” is considered the northeastern-most portion of the property that is previously developed. The site was previously being used as a Jiffy Lube auto-care facility but is now vacant and consists of a small building and dilapidated pavement. Big Y World Class Market is located directly adjacent to the site on the same property. Topography & Drainage The site generally slopes from an elevation of 148 at the south (near the access drive) to 146 at the north (towards the northern property line). The property sheet flows north into two catch basin inlets located near the northern portion of the property. The site’s existing impervious surface is 19,734 sq. ft. and its pervious surface is 2,577 sq. ft. The site lacks green infrastructure drainage design. Big Y Kiosk and Gas Station | Stormwater Management Report | 4 Soils The Soil Survey Map of the project site is based on available National Resource Conservation Service (NRCS) mapping website. NRCS soils mapping indicates the site consists of Amostown-Windsor silty substratum-urban land complex with a Hydrologic Soil Group (HSG) “B”. Type “B” soils have a well- drained to moderately well-drained infiltration capacity and low runoff class. The complete NRCS soil description data has been included as Appendix C. 3 PROPOSED CONDITIONS Proposed Uses The site will be redeveloped as a gas station with a small kiosk for sale transactions. The site consists of new paved parking, a new kiosk, new underground gas tanks, new pumps and dispensers, new overhead canopy, vegetative island buffers. The site also incorporates new green infrastructure drainage that addresses the required treatment train per the Massachusetts Stormwater Handbook. The proposed use classifies the site as a land use with higher potential pollutant loads (LUHPPL) per the Massachusetts Stormwater Handbook. Point of Analysis The discharge point is to remain the same under proposed conditions and there will be no anticipated changes to drainage patterns. Runoff will continue to flow north towards the two catch basin inlets at the northern portion of the property. Topography & Drainage The site’s proposed impervious surface is 19,621 sq. ft. and its pervious surface is 2,690 sq. ft (a reduction in impervious cover of 113 sq. ft). Peak flow rates for the site have not been computed, however it can be expected that they will be reduced under all design storms due to the increase in pervious surfaces. The site utilizes green infrastructure drainage design and best management practices (BMPs). The site’s runoff sheet flows to two proprietary separators (Hydroworks HydroStorm HS4i), then to a leaching catch basin which will allow infiltration. Additionally, the runoff from the canopy will be directed into sub-surface open bottom chambers (Stormtech SC-740) which will provide the required recharge volume for the site. Lastly, as part of the treatment train, semi-annual parking lot sweeping has been included as part of the site’s operation and maintenance plan which will provide an additional 5% TSS removal. Big Y Kiosk and Gas Station | Stormwater Management Report | 5 4 MA DEP STORMWATER MANAGEMENT STANDARDS Standard 1: No New Untreated Discharges Condition: No new stormwater conveyances (e.g. outfalls) may discharge untreated stormwater directly to or cause erosion in wetlands or waters of the Commonwealth. Result: ☒Satisfied ☐Unsatisfied The proposed stormwater design includes pretreatment for all site paved areas using street sweeping, proprietary separators, and leaching catch basins. This treatment train satisfies the requirements of this standard. Standard 2: Peak Rate Attenuation Condition: Stormwater management systems shall be designed so that the post-development peak discharge rates do not exceed pre-development peak discharge rates. Result: ☒Satisfied ☐Unsatisfied Peak flow rates for the site were not computed to compare pre- and post- development conditions, however, as previously mentioned, the site’s impervious cover is being reduced by 113 sq. ft under proposed conditions. This, by itself, will provide peak flow rate attenuation. Standard 3: Recharge to Groundwater Condition: Loss of annual recharge to groundwater shall be eliminated or minimized using environmentally sensitive site design, low impact development techniques, stormwater best management practices, and good operation and maintenance. At a minimum, the annual recharge from the post- development site shall approximate the annual recharge from pre-development conditions based on soil type. This Standard is met when the stormwater management system is designed to infiltrate the required recharge volume as determined in accordance with the Massachusetts Stormwater Handbook. Result: ☒Satisfied ☐Unsatisfied The proposed site recharge volume satisfies the requirements for this standard. Necessary computations follow: a) Impervious Area = pavement area, rooftops, canopies = 19,621 Ft2 (calculated using AutoCAD) Big Y Kiosk and Gas Station | Stormwater Management Report | 6 b) Required Recharge Volume = Required Recharge Volume, expressed in Ft3, cubic yards, or acre- feet F = Target Depth Factor associated with each Hydrologic Soil Group, (Table 2.3.2 Target Depth by Hydrologic Soil Group) = 0.35-inch, (Soil Group “B”) 0.35 in 1 ft12 in 19,621 Ft % &’( )*+ The Storm-Tech SC-740 chambers provide a storage volume of 615 ft3 which satisfies the requirements of this standard. See Appendix D for HydroCAD output demonstrating a storage volume of 615 ft3. c) Bottom Area Sizing for Infiltration Structures Amin. = Min. required surface area of the bottom of the infiltration structure R- = Required Recharge Volume = 572 Ft3 D = depth of the infiltration facility (If the infiltration facility is a practice that uses stone or another media such as a dry well, only the void spaces must be considered. In those circumstances, use n*d instead of d, where n is the percent porosity of the stone or other media.) = n.d.0 n%d%0 n1d1 … = air + crushed stone = (1)(2.5ft) + (.4)(1 ft) = 2.9 Ft K = saturated hydraulic conductivity. For “Simple Dynamic” Method, use Rawls Rate (See Table 2.3.3) = Sandy Loam, HSG “B”, 1.02 in/hr T = allowable drawdown during the peak of the storm (use 2 hours) Required Recharge Volume ) 3456789:;<76< Equation (1) Required Storage Volume (Simple Dynamic Method): =48>.?@A?B CDD E76F.=@ Big Y Kiosk and Gas Station | Stormwater Management Report | 7 Vreq. = Storage Volume determined in accordance with the “Simple Dynamic” Method =48>.572 Ft1 ?2.9ft 0 HIJ1.02 inhrMJ 1 ft12 inMN 2hrOD =48>.186 QR % E76F.186 Ft %2.9 Ft E76F.540 Ft 1 See Appendix D or HydroCAD output that demonstrates the system will provide 275.6 ft3 of storage within the chambers and 339.7 ft3 of storage within the crushed stone void spaces for a total of 615 ft3. TUVWU.615 Ft 1 X TVYZ.540 Ft 1 ∴ satisfied To confirm that the infiltration BMP will drain completely within 72 hours, the following was calculated: C846_7<‘_9‘>&’( )*+ ?Ja.b( 8>c7 a )*a( 8>Made )*(D C846_7<‘_9‘>+e.( c7;.f ’( c7;.∴ satisfied Standard 4: Water Quality Condition: Stormwater management systems shall be designed to remove 80% of the average annual post-construction load of Total Suspended Solids (TSS). This standard is met when: a) Suitable practices for source control and pollution prevention are identified in a long-term pollution prevention plan, and thereafter are implemented and maintained; b) Structural stormwater best management practices are sized to capture the required water quality volume as determined in accordance with the Massachusetts Stormwater Handbook; and c) Pretreatment is provided in accordance with the Massachusetts Stormwater Handbook. Drawdown within 72 Hours C846_7<‘_9‘>?B g9**94 =76<D Big Y Kiosk and Gas Station | Stormwater Management Report | 8 Result: ☒Satisfied ☐Unsatisfied This Standard has been met based on the proposed treatment train for the site, which includes street sweeping, leaching catch basins, and proprietary treatment practices. In conjunction with each other, this treatment train provides a total TSS removal of 91%. See Appendix D for computations. Standard 5: Land Uses with Higher Potential Pollutant Loads (HPPL) Condition: For land uses with higher potential pollutant loads, source control and pollution prevention shall be implemented in accordance with the Massachusetts Stormwater Handbook to eliminate or reduce the discharge of stormwater runoff from such land uses to the maximum extent practicable. If, through source control and/or pollution prevention, all land uses with higher potential pollutant loads cannot be completely protected from exposure to rain, snow, snow melt and stormwater runoff, the proponent shall use the specific structural stormwater BMPs determined by the Department to be suitable for such uses as provided in the Massachusetts Stormwater Handbook. Stormwater discharges from land uses with higher potential pollutant loads shall also comply with the requirements of the Massachusetts Clean Waters Act, M.G.L.c. 21, §§ 26-53 and the regulations promulgated thereunder at 314 CMR 3.00, 314 CMR 4.00 and 314 CMR 5.00. Result: ☒Satisfied ☐Unsatisfied The redeveloped site is exposed to Higher Potential Pollutant Loads (HPPL), since its use is an auto-fueling station (gas station). The pretreatment requirement for HPPL 44% TSS removal is achieved before discharge to an infiltration structure (leaching catch basin). The treatment train includes two proprietary separators (Hydroworks HS4i) which provide a TSS removal rate of 50%. See Appendix D for certification that the specified product provides 50% TSS removal rate. Standard 6: Critical Areas Condition: Stormwater discharges within the Zone II or Interim Wellhead Protection Area of a public water supply and stormwater discharges near or to any other critical area require the use of the specific source control and pollution prevention measures and the specific structural stormwater best management practices determined by the Department to be suitable for managing discharges to such areas, as provided in the Massachusetts Stormwater Handbook. A discharge is near a critical area if there is a strong likelihood of a significant impact occurring to said area, considering site-specific factors. Stormwater discharges to Outstanding Resource Waters and Special Resource Waters shall be removed and set back from the receiving water or wetland and receive the highest and best practical method of treatment. A “storm water discharge” as defined in 314 CMR 3.04(2)(a)1. or (b) to an Outstanding Resource Water or Big Y Kiosk and Gas Station | Stormwater Management Report | 9 Special Resource Water shall comply with 314 CMR 3.00 and 314 CMR 4.00. 1 Stormwater discharges to a Zone I or Zone A are prohibited unless essential to the operation of the public water supply. Result: ☒Satisfied ☐Unsatisfied The proposed site is not near a critical area. Therefore, this standard is not applicable. Standard 7: Redevelopment Condition: A redevelopment project is required to meet the following Stormwater Management Standards only to the maximum extent practicable: Standard 2, Standard 3, and the pretreatment and structural stormwater best management practice requirements of Standards 4, 5, and 6. Existing stormwater discharges shall comply with Standard 1 only to the maximum extent practicable. A redevelopment project shall also comply with all other requirements of the Stormwater Management Standards and improve existing conditions. Result: ☒Satisfied ☐Unsatisfied The Site conforms to all the requirements based on redevelopment. Standard 8: Construction Period Pollution and Erosion and Sedimentation Control Condition: A plan to control construction-related impacts, including erosion, sedimentation, and other pollutant sources during construction and land disturbance activities (construction period erosion, sedimentation, and pollution prevention plan) shall be developed and implemented. Result: ☒Satisfied ☐Unsatisfied The proposed site erosion and sediment control plan is attached in Appendix B. Standard 9: Operation and Maintenance (O&M) Plan Condition: A Long -Term Operation and Maintenance (O&M) Plan shall be developed and implemented to ensure that stormwater management systems function as designed. The Long-Term Operation and Maintenance Plan shall at a minimum include: Big Y Kiosk and Gas Station | Stormwater Management Report | 10 a) Stormwater management system(s) owners; b) The party or parties responsible for operation and maintenance, including how future property owners will be notified of the presence of the stormwater management system and the requirement for proper operation and maintenance; c) The routine and non-routine maintenance tasks to be undertaken after construction is complete and a schedule for implementing those tasks; d) A plan that is drawn to scale and shows the location of all stormwater BMPs in each treatment train along with the discharge point; e) A description and delineation of public safety features; and f) An estimated operations and maintenance budget. Result: ☒Satisfied ☐Unsatisfied The proposed Long -Term Operation and Maintenance (O&M) Plan is attached in Appendix E. Standard 10: Prohibition of Illicit Discharges Condition: All illicit discharges to the stormwater management system are prohibited. Result: ☒Satisfied ☐Unsatisfied The Prohibition of Illicit Discharges statement can be found in Appendix F. Big Y Kiosk and Gas Station | Stormwater Management Report | List of Appendices Appendix A MA – DEP Stormwater Checklist Appendix B Existing Condition Site Plan Proposed Conditions Site Plan Erosion and Sedimentation Control Plan Appendix C NRCS Soil Information Appendix D Pre- & Post-Development Drainage Calculations TSS Calculations Appendix E Stormwater System Long Term O&M Plan Appendix F Illicit Discharge Compliance Statement Appendix G NOAA Rainfall Data LIST OF APPENDICES Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix A APPENDIX A MA – DEP STORMWATER CHECKLIST 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 1 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report A. Introduction Important: When filling out forms on the computer, use only the tab key to move your cursor - do not use the return key. A Stormwater Report must be submitted with the Notice of Intent permit application to document compliance with the Stormwater Management Standards. The following checklist is NOT a substitute for the Stormwater Report (which should provide more substantive and detailed information) but is offered here as a tool to help the applicant organize their Stormwater Management documentation for their Report and for the reviewer to assess this information in a consistent format. As noted in the Checklist, the Stormwater Report must contain the engineering computations and supporting information set forth in Volume 3 of the Massachusetts Stormwater Handbook. The Stormwater Report must be prepared and certified by a Registered Professional Engineer (RPE) licensed in the Commonwealth. The Stormwater Report must include: · The Stormwater Checklist completed and stamped by a Registered Professional Engineer (see page 2) that certifies that the Stormwater Report contains all required submittals.1 This Checklist is to be used as the cover for the completed Stormwater Report. · Applicant/Project Name · Project Address · Name of Firm and Registered Professional Engineer that prepared the Report · Long-Term Pollution Prevention Plan required by Standards 4-6 · Construction Period Pollution Prevention and Erosion and Sedimentation Control Plan required by Standard 82 · Operation and Maintenance Plan required by Standard 9 In addition to all plans and supporting information, the Stormwater Report must include a brief narrative describing stormwater management practices, including environmentally sensitive site design and LID techniques, along with a diagram depicting runoff through the proposed BMP treatment train. Plans are required to show existing and proposed conditions, identify all wetland resource areas, NRCS soil types, critical areas, Land Uses with Higher Potential Pollutant Loads (LUHPPL), and any areas on the site where infiltration rate is greater than 2.4 inches per hour. The Plans shall identify the drainage areas for both existing and proposed conditions at a scale that enables verification of supporting calculations. As noted in the Checklist, the Stormwater Management Report shall document compliance with each of the Stormwater Management Standards as provided in the Massachusetts Stormwater Handbook. The soils evaluation and calculations shall be done using the methodologies set forth in Volume 3 of the Massachusetts Stormwater Handbook. To ensure that the Stormwater Report is complete, applicants are required to fill in the Stormwater Report Checklist by checking the box to indicate that the specified information has been included in the Stormwater Report. If any of the information specified in the checklist has not been submitted, the applicant must provide an explanation. The completed Stormwater Report Checklist and Certification must be submitted with the Stormwater Report. 1 The Stormwater Report may also include the Illicit Discharge Compliance Statement required by Standard 10. If not included in the Stormwater Report, the Illicit Discharge Compliance Statement must be submitted prior to the discharge of stormwater runoff to the post-construction best management practices. 2 For some complex projects, it may not be possible to include the Construction Period Erosion and Sedimentation Control Plan in the Stormwater Report. In that event, the issuing authority has the discretion to issue an Order of Conditions that approves the project and includes a condition requiring the proponent to submit the Construction Period Erosion and Sedimentation Control Plan before commencing any land disturbance activity on the site. 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 2 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report B. Stormwater Checklist and Certification The following checklist is intended to serve as a guide for applicants as to the elements that ordinarily need to be addressed in a complete Stormwater Report. The checklist is also intended to provide conservation commissions and other reviewing authorities with a summary of the components necessary for a comprehensive Stormwater Report that addresses the ten Stormwater Standards. Note: Because stormwater requirements vary from project to project, it is possible that a complete Stormwater Report may not include information on some of the subjects specified in the Checklist. If it is determined that a specific item does not apply to the project under review, please note that the item is not applicable (N.A.) and provide the reasons for that determination. A complete checklist must include the Certification set forth below signed by the Registered Professional Engineer who prepared the Stormwater Report. Registered Professional Engineer’s Certification I have reviewed the Stormwater Report, including the soil evaluation, computations, Long-term Pollution Prevention Plan, the Construction Period Erosion and Sedimentation Control Plan (if included), the Long- term Post-Construction Operation and Maintenance Plan, the Illicit Discharge Compliance Statement (if included) and the plans showing the stormwater management system, and have determined that they have been prepared in accordance with the requirements of the Stormwater Management Standards as further elaborated by the Massachusetts Stormwater Handbook. I have also determined that the information presented in the Stormwater Checklist is accurate and that the information presented in the Stormwater Report accurately reflects conditions at the site as of the date of this permit application. Registered Professional Engineer Block and Signature Signature and Date Checklist Project Type: Is the application for new development, redevelopment, or a mix of new and redevelopment? New development Redevelopment Mix of New Development and Redevelopment 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 3 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report Checklist (continued) LID Measures: Stormwater Standards require LID measures to be considered. Document what environmentally sensitive design and LID Techniques were considered during the planning and design of the project: No disturbance to any Wetland Resource Areas Site Design Practices (e.g. clustered development, reduced frontage setbacks) Reduced Impervious Area (Redevelopment Only) Minimizing disturbance to existing trees and shrubs LID Site Design Credit Requested: Credit 1 Credit 2 Credit 3 Use of “country drainage” versus curb and gutter conveyance and pipe Bioretention Cells (includes Rain Gardens) Constructed Stormwater Wetlands (includes Gravel Wetlands designs) Treebox Filter Water Quality Swale Grass Channel Green Roof Other (describe): Standard 1: No New Untreated Discharges No new untreated discharges Outlets have been designed so there is no erosion or scour to wetlands and waters of the Commonwealth Supporting calculations specified in Volume 3 of the Massachusetts Stormwater Handbook included. 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 4 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report Checklist (continued) Standard 2: Peak Rate Attenuation Standard 2 waiver requested because the project is located in land subject to coastal storm flowage and stormwater discharge is to a wetland subject to coastal flooding. Evaluation provided to determine whether off-site flooding increases during the 100-year 24-hour storm. Calculations provided to show that post-development peak discharge rates do not exceed pre- development rates for the 2-year and 10-year 24-hour storms. If evaluation shows that off-site flooding increases during the 100-year 24-hour storm, calculations are also provided to show that post-development peak discharge rates do not exceed pre-development rates for the 100-year 24- hour storm. Standard 3: Recharge Soil Analysis provided. Required Recharge Volume calculation provided. Required Recharge volume reduced through use of the LID site Design Credits. Sizing the infiltration, BMPs is based on the following method: Check the method used. Static Simple Dynamic Dynamic Field1 Runoff from all impervious areas at the site discharging to the infiltration BMP. Runoff from all impervious areas at the site is not discharging to the infiltration BMP and calculations are provided showing that the drainage area contributing runoff to the infiltration BMPs is sufficient to generate the required recharge volume. Recharge BMPs have been sized to infiltrate the Required Recharge Volume. Recharge BMPs have been sized to infiltrate the Required Recharge Volume only to the maximum extent practicable for the following reason: Site is comprised solely of C and D soils and/or bedrock at the land surface M.G.L. c. 21E sites pursuant to 310 CMR 40.0000 Solid Waste Landfill pursuant to 310 CMR 19.000 Project is otherwise subject to Stormwater Management Standards only to the maximum extent practicable. Calculations showing that the infiltration BMPs will drain in 72 hours are provided. Property includes a M.G.L. c. 21E site or a solid waste landfill and a mounding analysis is included. 1 80% TSS removal is required prior to discharge to infiltration BMP if Dynamic Field method is used. 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 5 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report Checklist (continued) Standard 3: Recharge (continued) The infiltration BMP is used to attenuate peak flows during storms greater than or equal to the 10- year 24-hour storm and separation to seasonal high groundwater is less than 4 feet and a mounding analysis is provided. Documentation is provided showing that infiltration BMPs do not adversely impact nearby wetland resource areas. Standard 4: Water Quality The Long-Term Pollution Prevention Plan typically includes the following: · Good housekeeping practices; · Provisions for storing materials and waste products inside or under cover; · Vehicle washing controls; · Requirements for routine inspections and maintenance of stormwater BMPs; · Spill prevention and response plans; · Provisions for maintenance of lawns, gardens, and other landscaped areas; · Requirements for storage and use of fertilizers, herbicides, and pesticides; · Pet waste management provisions; · Provisions for operation and management of septic systems; · Provisions for solid waste management; · Snow disposal and plowing plans relative to Wetland Resource Areas; · Winter Road Salt and/or Sand Use and Storage restrictions; · Street sweeping schedules; · Provisions for prevention of illicit discharges to the stormwater management system; · Documentation that Stormwater BMPs are designed to provide for shutdown and containment in the event of a spill or discharges to or near critical areas or from LUHPPL; · Training for staff or personnel involved with implementing Long-Term Pollution Prevention Plan; · List of Emergency contacts for implementing Long-Term Pollution Prevention Plan. A Long-Term Pollution Prevention Plan is attached to Stormwater Report and is included as an attachment to the Wetlands Notice of Intent. Treatment BMPs subject to the 44% TSS removal pretreatment requirement and the one inch rule for calculating the water quality volume are included, and discharge: is within the Zone II or Interim Wellhead Protection Area is near or to other critical areas is within soils with a rapid infiltration rate (greater than 2.4 inches per hour) involves runoff from land uses with higher potential pollutant loads. The Required Water Quality Volume is reduced through use of the LID site Design Credits. Calculations documenting that the treatment train meets the 80% TSS removal requirement and, if applicable, the 44% TSS removal pretreatment requirement, are provided. 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 6 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report Checklist (continued) Standard 4: Water Quality (continued) The BMP is sized (and calculations provided) based on: The ½” or 1” Water Quality Volume or The equivalent flow rate associated with the Water Quality Volume and documentation is provided showing that the BMP treats the required water quality volume. The applicant proposes to use proprietary BMPs, and documentation supporting use of proprietary BMP and proposed TSS removal rate is provided. This documentation may be in the form of the propriety BMP checklist found in Volume 2, Chapter 4 of the Massachusetts Stormwater Handbook and submitting copies of the TARP Report, STEP Report, and/or other third party studies verifying performance of the proprietary BMPs. A TMDL exists that indicates a need to reduce pollutants other than TSS and documentation showing that the BMPs selected are consistent with the TMDL is provided. Standard 5: Land Uses With Higher Potential Pollutant Loads (LUHPPLs) The NPDES Multi-Sector General Permit covers the land use and the Stormwater Pollution Prevention Plan (SWPPP) has been included with the Stormwater Report. The NPDES Multi-Sector General Permit covers the land use and the SWPPP will be submitted prior to the discharge of stormwater to the post-construction stormwater BMPs. The NPDES Multi-Sector General Permit does not cover the land use. LUHPPLs are located at the site and industry specific source control and pollution prevention measures have been proposed to reduce or eliminate the exposure of LUHPPLs to rain, snow, snow melt and runoff, and been included in the long term Pollution Prevention Plan. All exposure has been eliminated. All exposure has not been eliminated and all BMPs selected are on MassDEP LUHPPL list. The LUHPPL has the potential to generate runoff with moderate to higher concentrations of oil and grease (e.g. all parking lots with >1000 vehicle trips per day) and the treatment train includes an oil grit separator, a filtering bioretention area, a sand filter or equivalent. Standard 6: Critical Areas The discharge is near or to a critical area and the treatment train includes only BMPs that MassDEP has approved for stormwater discharges to or near that particular class of critical area. Critical areas and BMPs are identified in the Stormwater Report. 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 7 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report Checklist (continued) Standard 7: Redevelopments and Other Projects Subject to the Standards only to the maximum extent practicable The project is subject to the Stormwater Management Standards only to the maximum Extent Practicable as a: Limited Project Small Residential Projects: 5-9 single family houses or 5-9 units in a multi-family development provided there is no discharge that may potentially affect a critical area. Small Residential Projects: 2-4 single family houses or 2-4 units in a multi-family development with a discharge to a critical area Marina and/or boatyard provided the hull painting, service and maintenance areas are protected from exposure to rain, snow, snow melt and runoff Bike Path and/or Foot Path Redevelopment Project Redevelopment portion of mix of new and redevelopment. Certain standards are not fully met (Standard No. 1, 8, 9, and 10 must always be fully met) and an explanation of why these standards are not met is contained in the Stormwater Report. The project involves redevelopment and a description of all measures that have been taken to improve existing conditions is provided in the Stormwater Report. The redevelopment checklist found in Volume 2 Chapter 3 of the Massachusetts Stormwater Handbook may be used to document that the proposed stormwater management system (a) complies with Standards 2, 3 and the pretreatment and structural BMP requirements of Standards 4-6 to the maximum extent practicable and (b) improves existing conditions. Standard 8: Construction Period Pollution Prevention and Erosion and Sedimentation Control A Construction Period Pollution Prevention and Erosion and Sedimentation Control Plan must include the following information: · Narrative; · Construction Period Operation and Maintenance Plan; · Names of Persons or Entity Responsible for Plan Compliance; · Construction Period Pollution Prevention Measures; · Erosion and Sedimentation Control Plan Drawings; · Detail drawings and specifications for erosion control BMPs, including sizing calculations; · Vegetation Planning; · Site Development Plan; · Construction Sequencing Plan; · Sequencing of Erosion and Sedimentation Controls; · Operation and Maintenance of Erosion and Sedimentation Controls; · Inspection Schedule; · Maintenance Schedule; · Inspection and Maintenance Log Form. A Construction Period Pollution Prevention and Erosion and Sedimentation Control Plan containing the information set forth above has been included in the Stormwater Report. 70443.04_swcheck.doc • 04/01/08 Stormwater Report Checklist • Page 8 of 8 Massachusetts Department of Environmental Protection Bureau of Resource Protection - Wetlands Program Checklist for Stormwater Report Checklist (continued) Standard 8: Construction Period Pollution Prevention and Erosion and Sedimentation Control (continued) The project is highly complex and information is included in the Stormwater Report that explains why it is not possible to submit the Construction Period Pollution Prevention and Erosion and Sedimentation Control Plan with the application. A Construction Period Pollution Prevention and Erosion and Sedimentation Control has not been included in the Stormwater Report but will be submitted before land disturbance begins. The project is not covered by a NPDES Construction General Permit. The project is covered by a NPDES Construction General Permit and a copy of the SWPPP is in the Stormwater Report. The project is covered by a NPDES Construction General Permit but no SWPPP been submitted. The SWPPP will be submitted BEFORE land disturbance begins. Standard 9: Operation and Maintenance Plan The Post Construction Operation and Maintenance Plan is included in the Stormwater Report and includes the following information: Name of the stormwater management system owners; Party responsible for operation and maintenance; Schedule for implementation of routine and non-routine maintenance tasks; Plan showing the location of all stormwater BMPs maintenance access areas; Description and delineation of public safety features; Estimated operation and maintenance budget; and Operation and Maintenance Log Form. The responsible party is not the owner of the parcel where the BMP is located and the Stormwater Report includes the following submissions: A copy of the legal instrument (deed, homeowner’s association, utility trust or other legal entity) that establishes the terms of and legal responsibility for the operation and maintenance of the project site stormwater BMPs; A plan and easement deed that allows site access for the legal entity to operate and maintain BMP functions. Standard 10: Prohibition of Illicit Discharges The Long-Term Pollution Prevention Plan includes measures to prevent illicit discharges; An Illicit Discharge Compliance Statement is attached; NO Illicit Discharge Compliance Statement is attached but will be submitted prior to the discharge of any stormwater to post-construction BMPs. Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix B APPENDIX B EXISTING DRAINAGE MAP PROPOSED DRAINAGE MAP EROSION AND SEDIMENTATION CONTROL PLAN xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx NORTH KING STREETAREA E1 A = 0.51 Ac CN = 95 Tc = 6 Min. WATERSHED LEGEND WATERSHED BOUNDARY TIME OF CONCENTRATION PATH 1" = 20' 00 20'40' EDM Existing Drainage MapPLAN REFERENCE SITE INFORMATION FROM PLAN ENTITLED: " TOPOGRAPHIC SURVEY, PREPARED FOR BIG Y, INC., NORTH KING STREET, NORTHAMPTON, MA" SCALE 1" = 20', DATED AUGUST 2018, BY ALFRED BENESCH & CO., 120 HEBRON AVENUE, GLASTONBURY, CT 06033.PROPOSEDCONVENIENCE/FUELFACILITYNORTH KING STREETNORTHAMPTON, MAAlfred Benesch & Company 120 Hebron Avenue Glastonbury, Connecticut 06033 860-633-8341 2145 Roosevelt Avenue PO BOX 7840 Springfield, MA 01102-7840 xxxxxxxxxxxx x x x x NORTH KING STREET3+1 3+13+1 3+1 3+03+0 FFFVVRVRATGSTPATGSTPATGSTPMWMW10K SUPER 20K REGULAR 10K DIESEL IMIMFY 10' BEYOND TREE BELT10' TREE BELT6'MWMW1 4 6 14 7 1471461 4 5 146 146 14614 8 146 147 148 AREA P1 A = 0.51 Ac CN = 95 Tc = 6 Min. 1" = 20'PROPOSEDCONVENIENCE/FUELFACILITYNORTH KING STREETNORTHAMPTON, MAAlfred Benesch & Company 120 Hebron Avenue Glastonbury, Connecticut 06033 860-633-8341 2145 Roosevelt Avenue PO BOX 7840 Springfield, MA 01102-7840 00 20'40' PDM Proposed Drainage MapPLAN REFERENCE SITE INFORMATION FROM PLAN ENTITLED: " TOPOGRAPHIC SURVEY, PREPARED FOR BIG Y, INC., NORTH KING STREET, NORTHAMPTON, MA" SCALE 1" = 20', DATED AUGUST 2018, BY ALFRED BENESCH & CO., 120 HEBRON AVENUE, GLASTONBURY, CT 06033. xxxxxxxxxxxx x x x x NORTH KING STREET X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X CEEXISTING JIFFY LUBE BUILDING TO BE DEMOLISHED AND DISPOSED OF OFFSITE SILT SACK (TYP.) REMOVE BITUMINOUS PAVEMENT (TYP.) CONSTRUCTION ENTRANCE REMOVE EXISTING SIGN DUMPSTER ENCLOSURE TO BE REMOVED AND DISPOSED OF OFFSITE GUY ANCHOR TO BE RELOCATED COORDINATE WITH UTILITY OWNER REMOVE CONCRETE APRON (TYP.) REMOVE CURB (TYP.) REMOVE EXISTING TREE (TYP.)EXISTING LIGHT FIXTURE TO REMAIN AND BE PROTECTED SAWCUT PAVEMENT (TYP.) REMOVE BOLLARDS (TYP.) TEMPORARY STOCKPILE TEMPORARY CONCRETE WASHOUT STK CWA HB HB X X X X X X X X X X X X PORTION OF EXISTING WATER SERVICE TO BE REMOVED SITE PREP & EROSION CONTROL LEGEND REMOVE BITUMINOUS PAVEMENT REMOVE GRANITE CURB REMOVE CONCRETE CLEAR AND GRUB VEGETATION REMOVE ITEM X X X X X X X X X X X X X X X X X REMOVE BUILDING (BY OTHERS) SAWCUT (LIMIT OF DISTURBANCE) CE SILT FENCE STRAWBALE BARRIER CONSTRUCTION ENTRANCE SILT SACK CONSTRUCTION LIMIT LINE CLL CONCRETE WASHOUT AREA TEMPORARY MATERIAL STOCKPILE HB CWA STK PROPOSEDCONVENIENCE/FUELFACILITYNORTH KING STREETNORTHAMPTON, MAAlfred Benesch & Company 120 Hebron Avenue Glastonbury, Connecticut 06033 860-633-8341 2145 Roosevelt Avenue PO BOX 7840 Springfield, MA 01102-7840 C-0.0 Site Preparation & Erosion Control Plan 1" = 20' 00 20'40' PLAN REFERENCE SITE INFORMATION FROM PLAN ENTITLED: " TOPOGRAPHIC SURVEY, PREPARED FOR BIG Y, INC., NORTH KING STREET, NORTHAMPTON, MA" SCALE 1" = 20', DATED AUGUST 2018, BY ALFRED BENESCH & CO., 120 HEBRON AVENUE, GLASTONBURY, CT 06033. SITE PREPARATION NOTES: 1.CONTRACTOR SHALL NOTIFY “DIGSAFE” (811) AND VERIFY UTILITY MARK-OUT WITH THE OWNER PRIOR TO THE INITIATION OF ANY SITE DISTURBANCE. 2.THE CONTRACTOR IS SOLELY RESPONSIBLE FOR VERIFICATION OF THE LOCATION AND NATURE OF ALL SUBSURFACE UTILITIES AT THE PROJECT WHICH MAY BE AFFECTED BY THE WORK. COORDINATE WITH RESPECTIVE UTILITY OWNERS AND PERFORM VERIFICATION OF TYPE, LOCATION, AND INVERTS AS REQUIRED. 3.PROTECT ALL IMPROVEMENTS NOT INCLUDED WITHIN THE LIMITS OF WORK. ANY IMPROVEMENT WHICH IS DAMAGED SHALL BE REPAIRED OR REPLACED IN-KIND TO THE OWNER'S SATISFACTION. 4.DURING DEMOLITION, PROTECT ALL ADJACENT CURBING, SIDEWALKS, RAMPS, ABOVE-GRADE AND BELOW-GRADE UTILITIES, DRAINAGE STRUCTURES, LIGHT BASES, AND OTHER IMPROVEMENTS POTENTIALLY AFFECTED BY THE WORK. CLEARLY DELINEATE THE LIMITS OF WORK AND MARK, BARRICADE, OR OTHERWISE IDENTIFY THOSE IMPROVEMENTS THAT ARE TO BE PROTECTED AND/OR AVOIDED. ANY IMPROVEMENT WHICH IS DAMAGED SHALL BE REPAIRED OR REPLACED IN-KIND TO THE OWNER'S SATISFACTION. 5.CUT & CAP ALL EXISTING UTILITY CONNECTIONS AT THE ROW. CONFIRM WITH THE APPROPRIATE UTILITY. 6.THE LOCATIONS OF EXISTING SITE FEATURES AS SHOWN HAVE BEEN OBTAINED FROM MAPS, SURVEYS, FIELD INSPECTIONS, AND OTHER AVAILABLE INFORMATION. THEY MUST BE CONSIDERED APPROXIMATE BOTH TO LOCATION, SIZE, AND AS-BUILT CONDITION AND ARE PROVIDED FOR INFORMATIONAL PURPOSES ONLY. THE CONTRACTOR IS SOLELY RESPONSIBLE FOR DETERMINING ACTUAL FIELD CONDITIONS. 7.THE DIMENSIONS SHOWN ON THE PLANS, INCLUDING THE INTENDED DIMENSIONS OF THE WORK, MAY VARY FROM ACTUAL EXISTING CONDITIONS IN THE FIELD. THE CONTRACTOR SHALL TAKE APPROPRIATE MEASUREMENTS TO VERIFY ALL DIMENSIONS SHOWN ON THE DRAWINGS AS WELL AS OTHER DIMENSIONS HE MAY DEEM APPROPRIATE TO FACILITATE THE COMPLETION OF THE WORK. NOTIFY THE ENGINEER OF ANY DISCREPANCIES BETWEEN EXISTING CONDITIONS AND THE CONTRACT DOCUMENTS BEFORE PROCEEDING WITH THAT PORTION OF THE WORK. 8.IMPLEMENTING WORKER SAFETY AND/OR HEALTH PROTOCOLS THAT ADDRESS COMPLIANCE WITH RULES, LAWS, AND REGULATIONS PERTAINING TO CONSTRUCTION SAFETY AND/OR THE POTENTIAL AND/OR ACTUAL RISK OF EXPOSURE TO SITE-SPECIFIC PHYSICAL OR CHEMICAL HAZARDS IS SOLELY THE RESPONSIBILITY OF THE CONTRACTOR. 9.PRIOR TO THE TERMINATION, ABANDONMENT, OR REMOVAL OF ANY UTILITY, VERIFY THAT APPLICABLE NOTIFICATIONS HAVE BEEN MADE TO THE UTILITY OWNER/OPERATOR AND THAT THE UTILITY HAS BEEN PROPERLY TERMINATED, CAPPED, OR PLUGGED AS REQUIRED. 10.PROVIDE PAVEMENT SAWCUT AT THE EDGE OF EACH PAVEMENT REMOVAL AREA TO ESTABLISH A CLEAN EDGE WHERE NEW WORK WILL MEET EXISTING PAVEMENT. SAWCUT SHALL BE A MINIMUM OF 12 INCHES FROM EDGE OF PAVEMENT REMOVAL. 11.UNLESS OTHERWISE INDICATED, ALL DISTURBED AREAS SHALL BE RESTORED WITH SIX (6) INCHES OF LOAM, SEEDED, FERTILIZED, AND MULCHED. PROVIDE ADDITIONAL EROSION CONTROLS AS REQUIRED. 12.ALL SIDEWALK CLOSURES AND MEASURES FOR TEMPORARY PEDESTRIAN ACCESS, SIDEWALKS, CROSSINGS, AND BIKE LANES SHALL MEET THE APPROVAL OF THE CITY OF NORTHAMPTON. FILTER INSERTS IN DRAINAGE SYSTEM WEEKLY & WITHIN 24 HOURS AFTER STORM GENERATING A DISCHARGE MAINTENANCE MEASURES SCHEDULEE&S MEASURE TEMPORARY E&S MEASURES MAINTENANCE SCHEDULE TARP TEMPORARY STOCKPILES DAILY HAY BALES/ SILT FENCE BARRIER WEEKLY & WITHIN 24 HOURS AFTER STORM GENERATING A DISCHARGE CONSTRUCTION ENTRANCE WEEKLY MOISTEN EXPOSED SOILS DAILY EROSION AND SEDIMENT CONTROL NOTES: 1.THIS PLAN IS FOR EROSION AND SEDIMENTATION (E&S) CONTROL ONLY. SEE OTHER PLANS FOR THE SCOPE OF CONSTRUCTION WORK. 2.THE MEASURES SPECIFIED HEREON ARE THE MINIMUM REQUIREMENTS FOR E&S CONTROL AND ARE SHOWN IN GENERAL SIZE AND LOCATION ONLY. THE CONTRACTOR SHALL BE RESPONSIBLE FOR ENSURING THAT ALL E&S CONTROL MEASURES ARE CONFIGURED AND CONSTRUCTED IN A MANNER THAT WILL MINIMIZE EROSION OF SOILS AND PREVENT THE TRANSPORT OF SEDIMENTS AND OTHER POLLUTANTS TO ANY RESOURCE AREAS. PROVIDE ADDITIONAL E&S MEASURES AS REQUIRED TO CONTROL EROSION AND SILTATION THROUGHOUT THE DURATION OF THE CONSTRUCTION AS CONDITIONS DICTATE AND/OR AS DIRECTED BY THE OWNER OR THE ENGINEER. 3.MONITOR AND INSPECT ALL E&S MEASURES IN AN ONGOING MANNER THROUGHOUT THE WORK AND TAKE CORRECTIVE MEASURES, AS REQUIRED, TO MINIMIZE EROSION OF SOILS AND PREVENT THE TRANSPORT OF SEDIMENTS AND OTHER POLLUTANTS TO ANY RESOURCE AREAS.ANY EROSION AND SEDIMENTATION MEASURE IMPLEMENTED BEYOND THAT SHOWN HEREON SHALL CONFORM TO APPLICABLE SECTIONS OF THE 1997 MASSACHUSETTS EROSION AND SEDIMENT CONTROL GUIDELINES FOR URBAN AND SUBURBAN AREAS AS AMENDED. 4.ANY STOCKPILED MATERIAL SHALL BE SUBJECT TO EROSION CONTROL MEASURES THAT INCLUDE A MINIMUM OF SILT FENCE OR HAY BALE BARRIER. COVER STOCKPILES IF SIGNIFICANT RAINFALL IS PREDICTED. 5.PROVIDE TEMPORARY SEEDING WITH MULCH ON ALL EXPOSED SOIL AREAS WHERE WORK WILL BE SUSPENDED FOR LONGER THAN 30 DAYS. APPLY SEED AND MULCH WITHIN THE FIRST 7 DAYS OF SUSPENDING WORK. WHEN SEEDING IS NOT POSSIBLE DUE TO SEASONAL WEATHER CONDITIONS OR OTHER FACTORS, PROVIDE TEMPORARY STRUCTURAL SOIL PROTECTION SUCH AS MULCH, WOODCHIPS, EROSION CONTROL MATTING, OR COMPOST. 6.ALL TEMPORARY SLOPES IN EXCESS OF 3 (HORIZONTAL) TO 1 (VERTICAL) SHALL BE STABILIZED WITH EROSION CONTROL MATTING OR APPROVED EQUIVALENT. 7.NO RUNOFF SHALL BE ALLOWED TO ENTER ANY STORMWATER SYSTEM OR EXIT THE SITE PRIOR TO TREATMENT FOR SEDIMENT REMOVAL. 8.THE CONTRACTOR SHALL MAINTAIN A CLEAN CONSTRUCTION SITE AND SHALL NOT ALLOW THE ACCUMULATION OF RUBBISH OR CONSTRUCTION DEBRIS. ALL TRASH SHALL BE CLEANED ON A DAILY BASIS AND THE SITE SHALL BE LEFT IN A NEAT CONDITION AT THE END OF EACH WORK DAY. 9.TAKE ALL NECESSARY PRECAUTIONS TO AVOID THE SPILLAGE OF FUEL OR OTHER POLLUTANTS AND ADHERE TO ALL APPLICABLE POLICIES AND REGULATIONS RELATED TO SPILL PREVENTION, CONTROL, AND RESPONSE. 10.FOR DUST CONTROL, PERIODICALLY MOISTEN EXPOSED SOIL SURFACES WITH WATER AND MAINTAIN ADEQUATE MOISTURE LEVELS. 11.SWEEP ADJACENT ROADWAYS IF MUD OR SOIL IS TRACKED ON TO THEM, OR AS DIRECTED BY THE ENGINEER. CLEAN CATCH BASIN GRATE, REMOVE SEDIMENT/DEBRIS FROM FILTER INSERTS REPAIR/REPLACE WHEN FAILURE OBSERVED, REMOVE SILT WHEN ACCUMULATION REACHES APPROX. HALF HEIGHT OF BARRIER ENSURE TARP IS SECURED OVER STOCKPILE AT THE END OF EACH DAY SWEEP PAVED ROADWAY ADJACENT TO SITE ENTRANCE AS NECESSARY, REFRESH STONE AS NECESSARY, REMOVE SILTED GRAVEL PERIODICALLY MOISTEN EXPOSED SOIL SURFACES WITH WATER ON UNPAVED TRAVELWAYS AND KEEP TRAVELWAYS DAMP PROPOSEDCONVENIENCE/FUELFACILITYNORTH KING STREETNORTHAMPTON, MAAlfred Benesch & Company 120 Hebron Avenue Glastonbury, Connecticut 06033 860-633-8341 2145 Roosevelt Avenue PO BOX 7840 Springfield, MA 01102-7840 C-8.0 Erosion and Sedimentation Control DetailsCONSTRUCTION ENTRANCE (CE) N.T.S. SILT FENCE BARRIER (SF) N.T.S. 2'-6" 1'-6" SECTIONELEVATION *NOTE: POST SPACING AND EMBEDMENT VARIES BASED ON THE FABRIC MANUFACTURER'S REQUIREMENTS.EXTRA STRENGTH SEDIMENT CONTROL FABRIC (AMOCO PROPEX OR EQUAL) 10' MAX.* 100° BURY FABRIC 6" BELOW GROUND GRADE WOOD POST SLOPE 1" REBAR FOR BAG REMOVAL FROM INLET (REBAR NOT INCLUDED) OPTIONAL OVERFLOW SILTSACK® DUMP LOOPS (REBAR NOT INCLUDED)FOAM INSERT 'SILTSACK' SEDIMENT CONTROL DEVICE, TERRAFIX GEOSYNTHETICS INC. TORONTO, ONTARIO, CA WWW.TERRAFIXGEO.COM SILT SACK DETAIL (SS) N.T.S. STAKED STRAW BALES CROSS-SECTION PLAN VIEW FIELD VARIABLE FIELD VARIABLE10' (MIN.) OVERLAP 1' NOTES: 1.CONSTRUCT WASHOUT AREA LARGE ENOUGH TO ENSURE MATERIALS WILL BE CONTAINED WHERE WASTE CONCRETE CAN SOLIDIFY IN PLACE AND EXCESS WATER CAN SAFELY EVAPORATE. 2.WASHOUT AREA SHALL BE LARGE ENOUGH TO RETAIN ALL LIQUID AND WASTE CONCRETE MATERIALS FROM WASHOUT OPERATION. 3.WEEKLY INSPECTIONS OF WASHOUT AREAS SHALL BE CONDUCTED TO ASSESS THE HOLDING CAPACITY AND FUNCTIONALITY OF THE WASHOUT AREA. NON-WOVEN GEOTEXTILE FILTER FABRIC SECURE FABRIC WITH EROSION CONTROL STAPLES FILTER FABRIC 11 2"x11 2"x36" WOOD STAKE OR STEEL POSTS WITH A MIN. OF 0.5 POUNDS PER LINEAR FOOT (2 PER STRAW BALE) FILTER FABRIC BURY FILTER FABRIC 4" N.T.S. TEMPORARY CONCRETE WASHOUT AREA (CWA) 6' SILT FENCE SURROUNDING STOCKPILE TEMPORARY VEGETATIVE COVER TO BE ESTABLISHED ON TOPSOIL STOCKPILE 3:1 SLOPE MAX TEMPORARY MATERIAL STOCKPILE (STK) N.T.S. STRAW BALE BARRIER (HB) N.T.S. PROTECTED WORK AREA FLOW TOP OF GROUND 18" (MIN.) AREA STRAW BALES BINDINGS TO BE PARALLEL TO GROUND SURFACE EMBED STRAW BALES 4" INTO GROUND. BACKFILL AND COMPACT EXCAVATED FILL ALONG STRAW BALES 11 2"x11 2"x36" WOOD STAKE OR STEEL POSTS WITH A MIN. OF 0.5 POUNDS PER LINEAR FOOT (2 PER STRAW BALE) NOTES: 1.STRAW BALES SHALL BE MADE OF STRAW WITH 40 POUND MIN. WEIGHT AND 120 POUND MAX. WEIGHT HELD TOGETHER BY TWINE OR WIRE. 2.PLACE STRAW BALES ON CONTOUR AND WING THE LAST STRAW BALES UP SLOPE SO THAT THE TOP OF THE LAST SEVERAL STRAW BALES ARE HIGHER THAN THE LINE OF STRAW BALES. 3.DRIVE FIRST STAKE IN EACH BALE TOWARD THE PREVIOUSLY LAID BALE TO FORCE THEM TOGETHER. 4.PUT ONE STRAW BALE PERPENDICULAR ALONG STRAW BALE BARRIER EACH 100 FEET. NOTE: LOCATION TO BE DETERMINED IN THE FIELD BY THE CONSTRUCTION ADMINISTRATOR SECTION PUBLI C R O A D PLAN TREE BELT/SNOW SHELF - 7'-0" (TYP) 5'-0" (MIN.) SIDEWALK - 5'-0" (MIN.) 2 1/2" (MIN.) - BIT. CONC. BINDER COURSE ANGULAR STONE 4" MIN. DEPTH FILTER FABRIC COMPACTED SUBGRADE ANGULAR STONE 4" MIN. DEPTH COMPACTED SUBGRADE FILTER FABRIC R=15' (TYP.) (MIN.) 2 5 ' - 0 " M IN . 5 0 ' - 0 " M IN . 12'-0" MIN. CURB MONITORING AND MAINTENANCE PROGRAM - GENERAL A.FOR THE DURATION OF THE PROJECT CONSTRUCTION, THE CONTRACTOR SHALL MAINTAIN ALL SEDIMENTATION AND EROSION CONTROL DEVICES TO INSURE THEIR EFFICIENT OPERATION. B.THE RESPONSIBILITY FOR PERFORMING PERIODIC CHECKS OF THE PROTECTION SYSTEM IN-PLACE AND TO COORDINATE CLEANING AND REPAIR OPERATIONS SHALL BE ASSIGNED TO THE GENERAL CONTRACTOR'S PROJECT REPRESENTATIVE. C.ALL SEDIMENTATION AND EROSION CONTROL DEVICES SHALL BE CHECKED FOR THE ADEQUACY OF THE CONTROL SYSTEMS PRIOR TO SEVERE STORM WEATHER FORECASTS . INSPECT CONTROL SYSTEM DURING AND AFTER STORMS TO DETERMINE NECESSARY REPAIRS. D.REPAIRS TO SEDIMENTATION CONTROL SYSTEMS DIRECTED BY THE PROJECT REPRESENTATIVE SHALL BE DONE WITHIN 24 HOURS OF THE DIRECTIVE OR AS SOON AS POSSIBLE PRIOR TO STORM WARNINGS. E.REPLACEMENT MATERIALS FOR THE DEVICES UTILIZED MUST BE READILY AVAILABLE FOR REPAIRS. F.CLEAN SEDIMENTATION AND EROSION CONTROL DEVICES AS DIRECTED BY THE PROJECTS REPRESENTATIVE. G.PLACEMENT OF TEMPORARY SEDIMENTATION AND EROSION CONTROL DEVICES THAT ARE NOT SHOWN ON PLANS, BUT ARE REQUIRED DUE TO CONTRACTOR'S OPERATIONS, SHALL BE PLACED AT THE DIRECTION OF THE PROJECTS REPRESENTATIVE. H.DUST CONTROL AND OFF-SITE DEBRIS CAUSED BY THE CONTRACTOR'S EARTHWORK OPERATIONS SHALL BE PREVENTED, OR CLEANED-UP IN ACCORDANCE WITH THE 1997 MASSACHUSETTS EROSION AND SEDIMENT CONTROL GUIDELINES FOR URBAN AND SUBURBAN AREAS. MONITORING AND MAINTENANCE PROGRAM MEASURES - SPECIFIC A.GEOTEXTILE SILT FENCE (SF) - INSPECT SF AT LEAST ONCE A WEEK AND WITHIN 24 HOURS OF THE END OF ANY STORM EVENT OF 0.5-INCH OR GREATER. REPAIR OR REPLACE THE FENCE WITHIN 24-HOURS OF OBSERVED FAILURE. B.SEEDING (TS & PS) - INSPECT SEEDED AREA AT LEAST ONCE A WEEK AND WITHIN 24 HOURS OF THE END OF A STORM WITH A RAINFALL AMOUNT OF 0.5 INCH OR GREATER FOR SEED AND MULCH MOVEMENT AND RILL EROSION. WHERE SEED HAS MOVED OR WHERE SOIL EROSION HAS OCCURRED, DETERMINE THE CAUSE OF THE FAILURE. BIRD FEEDING MAY BE A PROBLEM IF MULCH WAS APPLIED TOO THINLY TO PROTECT SEED. RE-SEED AND RE-MULCH. IF MOVEMENT WAS THE RESULT OF WIND, THEN REPAIR EROSION DAMAGE (IF ANY), REAPPLY SEED AND MULCH AND APPLY MULCH ANCHORING. IF FAILURE WAS CAUSED BY CONCENTRATED RUNOFF, INSTALL ADDITIONAL MEASURES TO CONTROL WATER AND SEDIMENT MOVEMENT, REPAIR EROSION DAMAGE, RE-SEED AND RE-APPLY MULCH WITH ANCHORING OR USE TEMPORARY EROSION CONTROL BLANKET MEASURE. CONTINUE INSPECTIONS UNTIL THE GRASSES ARE FIRMLY ESTABLISHED. GRASSES SHALL NOT BE CONSIDERED ESTABLISHED UNTIL A GROUND COVER IS ACHIEVED WHICH IS MATURE ENOUGH TO CONTROL SOIL EROSION AND TO SURVIVE SEVERE WEATHER CONDITIONS (APPROXIMATELY 80% VEGETATIVE SURFACE COVER). C.STRAW BALE BARRIER (HB) - INSPECT HB AT LEAST ONCE A WEEK AND WITHIN 24 HOURS OF THE END OF ANY STORM EVENT OF 0.5-INCH OR GREATER. REPAIR OR REPLACE THE STRAW BALES WITHIN 24-HOURS OF OBSERVED FAILURE. D.CONSTRUCTION ENTRANCE (CE) - MAINTAIN THE ENTRANCE IN A CONDITION WHICH WILL PREVENT TRACKING AND WASHING OF SEDIMENT ONTO PAVED SURFACES. PROVIDE PERIODIC TOP DRESSING WITH ADDITIONAL STONE OR ADDITIONAL LENGTH AS CONDITIONS DEMAND. REPAIR ANY MEASURES USED TO TRAP SEDIMENT AS NEEDED. IMMEDIATELY REMOVE ALL SEDIMENT SPILLED, DROPPED, WASHED OR TRACKED ONTO PAVED SURFACES. ROADS ADJACENT TO A CONSTRUCTION SITE SHALL BE LEFT CLEAN AT THE END OF EACH DAY. IF THE CONSTRUCTION ENTRANCE IS BEING PROPERLY MAINTAINED AND THE ACTION OF A VEHICLE TRAVELING OVER THE STONE PAD IS NOT SUFFICIENT TO REMOVE THE MAJORITY OF THE SEDIMENT, THEN EITHER (1) INCREASE THE LENGTH OF THE CONSTRUCTION ENTRANCE, (2) MODIFY THE CONSTRUCTION ACCESS ROAD SURFACE, OR (3) INSTALL WASHING RACKS AND ASSOCIATED SETTLING AREA OR SIMILAR DEVICES BEFORE THE VEHICLE ENTERS A PAVED SURFACE. EROSION AND SEDIMENTATION CONTROL NARRATIVE PER STATE OF MASSACHUSETTS ALL APPLICABLE PRACTICES RECOMMENDED BY THE 1997 MASSACHUSETTS EROSION AND SEDIMENT CONTROL GUIDELINES FOR URBAN AND SUBURBAN AREAS AS AMENDED. DESCRIPTION THE PROJECT CONSISTS OF REDEVELOPING AN ABANDONED SITE INTO A NEW GAS STATION AND KIOSK. THE EXISTING BUILDING, PAVED PARKING, AND OTHER EXISTING AMENITIES WILL BE DEMOLISHED. THE PROPOSED DEVELOPMENT CONSISTS OF A NEW KIOSK, NEW UNDERGROUND PUMP AND TANK SYSTEM INCLUDING DISPENSERS WITH AN OVERHEAD CANOPY, AND LANDSCAPING IMPROVEMENTS AS SHOWN ON THE DESIGN PLANS. CONSTRUCTION WILL INVOLVE SITE GRADING, PAVING, DRAINAGE, AND CONSTRUCTION OF THE KIOSK. DESIGN AND CRITERIA NOTE: THE CONTRACTOR SHALL NAME ONE INDIVIDUAL AS HIS SEDIMENT AND EROSION CONTROL SUPERVISOR WHOSE PRIMARY RESPONSIBILITY WILL BE THE MAINTENANCE OF ALL ON-SITE EROSION CONTROL MEASURES. HE WILL KEEP A DAILY LOG OF HIS ACTIVITIES AND AN UPDATED SCHEDULE OF PROPOSED CONSTRUCTION ACTIVITIES. THE LOG WILL BE MADE AVAILABLE TO INSPECTORS. A.GEOTEXTILE SILT FENCE (SF) - SHALL BE NON-WOVEN MATERIAL, MINIMUM 36" HIGH AND FASTENED TO WOOD STAKES. SILT FENCE SHALL BE INSTALLED WITH END RUNS TURNED UP GRADE AT 45 DEGREES FOR A DISTANCE OF 10 FEET (SEE DETAIL THIS SHEET). B.TEMPORARY SEEDING (TS) 1.CONTRACTOR SHALL SCARIFY THE SOIL TO A DEPTH OF 2" BEFORE APPLYING FERTILIZER, LIMESTONE AND SEED. 2.SEED MAY BE APPLIED BY HAND OR MECHANICALLY. SEED APPLICATION SHALL BE UNIFORM. SEED RATE SHALL BE IN ACCORDANCE WITH THE 1997 MASSACHUSETTS EROSION AND SEDIMENT CONTROL GUIDELINES FOR URBAN AND SUBURBAN AREAS AS AMENDED (INCREASE SEEDING RATES BY 10% WHEN HYDROSEEDING, LIMESTONE, FERTILIZER AND SEED MAY BE APPLIED IN SLURRY.) 3.CONTRACTOR SHALL MULCH AREA (MS) IMMEDIATELY FOLLOWING SEEDING. (NOTE: IN THE EVENT SEEDING OPERATIONS ARE NOT FEASIBLE DUE TO SEASONAL RESTRICTIONS OR EXTENDED INCLEMENT WEATHER PATTERNS, THE CONTRACTOR SHALL INSTALL AN EROSION CONTROL BLANKET OVER EXPOSED SOILS.) C.PERMANENT SEEDING (PS) 1.CONTRACTOR SHALL APPLY TOPSOIL AND FINE GRADE ALL AREAS BEFORE THE APPLICATION OF PERMANENT SEED. APPLY LIMESTONE AND FERTILIZER AS NEEDED, IN ACCORDANCE WITH SOIL TESTS. 2.REMOVE ALL SURFACE STONES ½ INCH AND LARGER. REMOVE ALL OTHER DEBRIS AND RAKE SEED BED. 3.APPLY SEED WITHIN 7 DAYS AFTER ESTABLISHING FINAL GRADES. SEE PLANTING PLAN. D.STRAW BALE BARRIER (HB) - SHALL BE MADE OF STRAW WITH 40 POUNDS MINIMUM WEIGHT AND 120 POUNDS MAXIMUM WEIGHT, HELD TOGETHER BY TWINE OR WIRE. (SEE DETAIL THIS SHEET.) E.CONSTRUCTION ENTRANCE (CE) - SHALL BE AN ANGULAR STONE PAD, A MINIMUM OF 12' WIDE AND 50' LONG. (SEE DETAIL THIS SHEET.) APPLICATION/GENERAL PROCEDURES SOIL EROSION AND SEDIMENT CONTROL MEASURES WILL BE INSTALLED PRIOR TO ANY SITE DISTURBANCE, AND DEVELOPMENT WILL PROCEED ACCORDING TO A SPECIFIC CONSTRUCTION SEQUENCE. THE OBJECTIVE IS TO MAXIMIZE THE REDUCTION OF SEDIMENT-LADEN RUNOFF THROUGH IMPLEMENTATION OF CONVENTIONAL SOIL SEDIMENTATION AND EROSION CONTROL PRACTICES CURRENTLY RECOMMENDED BY THE 1997 MASSACHUSSETTS EROSION AND SEDIMENT CONTROL GUIDELINES FOR URBAN AND SUBURBAN AREAS. A.EARTHWORK WILL BE SCHEDULED FOR PERIODS WHEN SOIL SATURATION IS LOW AND SOIL LOSS HAZARD IS AT A MINIMUM. B.SUSPEND EARTHWORK FOR MAJOR STORM EVENTS AND IMPLEMENT ADDITIONAL SEDIMENTATION AND EROSION CONTROL MEASURES AS NECESSARY. C.THERE SHALL BE NO CUTS OR FILL LEFT EXPOSED FOR LONGER THAN 30 DAYS. THE ESTABLISHED PROCEDURE OF TEMPORARILY SEEDING AND/OR COVER WITH EROSION PROTECTION (MAT OR STRAW) SHALL BE FOLLOWED TO INSURE MINIMAL SOIL LOSS. D.THE DISCHARGE OF UNTREATED STORMWATER TO ANY ADJACENT ROADWAYS, DRAINAGE INLETS, OR PROPERTIES IS NOT ALLOWED. Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix C APPENDIX C NRCS SOIL INFORMATION United States Department of Agriculture A product of the National Cooperative Soil Survey, a joint effort of the United States Department of Agriculture and other Federal agencies, State agencies including the Agricultural Experiment Stations, and local participants Custom Soil Resource Report for Hampshire County, Massachusetts, Central Part Big Y Northampton Natural Resources Conservation Service January 7, 2021 Preface Soil surveys contain information that affects land use planning in survey areas. They highlight soil limitations that affect various land uses and provide information about the properties of the soils in the survey areas. Soil surveys are designed for many different users, including farmers, ranchers, foresters, agronomists, urban planners, community officials, engineers, developers, builders, and home buyers. Also, conservationists, teachers, students, and specialists in recreation, waste disposal, and pollution control can use the surveys to help them understand, protect, or enhance the environment. Various land use regulations of Federal, State, and local governments may impose special restrictions on land use or land treatment. Soil surveys identify soil properties that are used in making various land use or land treatment decisions. The information is intended to help the land users identify and reduce the effects of soil limitations on various land uses. The landowner or user is responsible for identifying and complying with existing laws and regulations. Although soil survey information can be used for general farm, local, and wider area planning, onsite investigation is needed to supplement this information in some cases. Examples include soil quality assessments (http://www.nrcs.usda.gov/wps/ portal/nrcs/main/soils/health/) and certain conservation and engineering applications. For more detailed information, contact your local USDA Service Center (https://offices.sc.egov.usda.gov/locator/app?agency=nrcs) or your NRCS State Soil Scientist (http://www.nrcs.usda.gov/wps/portal/nrcs/detail/soils/contactus/? cid=nrcs142p2_053951). Great differences in soil properties can occur within short distances. Some soils are seasonally wet or subject to flooding. Some are too unstable to be used as a foundation for buildings or roads. Clayey or wet soils are poorly suited to use as septic tank absorption fields. A high water table makes a soil poorly suited to basements or underground installations. The National Cooperative Soil Survey is a joint effort of the United States Department of Agriculture and other Federal agencies, State agencies including the Agricultural Experiment Stations, and local agencies. The Natural Resources Conservation Service (NRCS) has leadership for the Federal part of the National Cooperative Soil Survey. Information about soils is updated periodically. Updated information is available through the NRCS Web Soil Survey, the site for official soil survey information. The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, age, disability, and where applicable, sex, marital status, familial status, parental status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because all or a part of an individual's income is derived from any public assistance program. (Not all prohibited bases apply to all programs.) Persons with disabilities who require 2 alternative means for communication of program information (Braille, large print, audiotape, etc.) should contact USDA's TARGET Center at (202) 720-2600 (voice and TDD). To file a complaint of discrimination, write to USDA, Director, Office of Civil Rights, 1400 Independence Avenue, S.W., Washington, D.C. 20250-9410 or call (800) 795-3272 (voice) or (202) 720-6382 (TDD). USDA is an equal opportunity provider and employer. 3 Contents Preface....................................................................................................................2 How Soil Surveys Are Made..................................................................................5 Soil Map..................................................................................................................8 Soil Map................................................................................................................9 Legend................................................................................................................10 Map Unit Legend................................................................................................12 Map Unit Descriptions........................................................................................12 Hampshire County, Massachusetts, Central Part...........................................14 741A—Amostown-Windsor silty substratum-Urban land complex, 0 to 3 percent slopes....................................................................................14 References............................................................................................................16 4 How Soil Surveys Are Made Soil surveys are made to provide information about the soils and miscellaneous areas in a specific area. They include a description of the soils and miscellaneous areas and their location on the landscape and tables that show soil properties and limitations affecting various uses. Soil scientists observed the steepness, length, and shape of the slopes; the general pattern of drainage; the kinds of crops and native plants; and the kinds of bedrock. They observed and described many soil profiles. A soil profile is the sequence of natural layers, or horizons, in a soil. The profile extends from the surface down into the unconsolidated material in which the soil formed or from the surface down to bedrock. The unconsolidated material is devoid of roots and other living organisms and has not been changed by other biological activity. Currently, soils are mapped according to the boundaries of major land resource areas (MLRAs). MLRAs are geographically associated land resource units that share common characteristics related to physiography, geology, climate, water resources, soils, biological resources, and land uses (USDA, 2006). Soil survey areas typically consist of parts of one or more MLRA. The soils and miscellaneous areas in a survey area occur in an orderly pattern that is related to the geology, landforms, relief, climate, and natural vegetation of the area. Each kind of soil and miscellaneous area is associated with a particular kind of landform or with a segment of the landform. By observing the soils and miscellaneous areas in the survey area and relating their position to specific segments of the landform, a soil scientist develops a concept, or model, of how they were formed. Thus, during mapping, this model enables the soil scientist to predict with a considerable degree of accuracy the kind of soil or miscellaneous area at a specific location on the landscape. Commonly, individual soils on the landscape merge into one another as their characteristics gradually change. To construct an accurate soil map, however, soil scientists must determine the boundaries between the soils. They can observe only a limited number of soil profiles. Nevertheless, these observations, supplemented by an understanding of the soil-vegetation-landscape relationship, are sufficient to verify predictions of the kinds of soil in an area and to determine the boundaries. Soil scientists recorded the characteristics of the soil profiles that they studied. They noted soil color, texture, size and shape of soil aggregates, kind and amount of rock fragments, distribution of plant roots, reaction, and other features that enable them to identify soils. After describing the soils in the survey area and determining their properties, the soil scientists assigned the soils to taxonomic classes (units). Taxonomic classes are concepts. Each taxonomic class has a set of soil characteristics with precisely defined limits. The classes are used as a basis for comparison to classify soils systematically. Soil taxonomy, the system of taxonomic classification used in the United States, is based mainly on the kind and character of soil properties and the arrangement of horizons within the profile. After the soil 5 scientists classified and named the soils in the survey area, they compared the individual soils with similar soils in the same taxonomic class in other areas so that they could confirm data and assemble additional data based on experience and research. The objective of soil mapping is not to delineate pure map unit components; the objective is to separate the landscape into landforms or landform segments that have similar use and management requirements. Each map unit is defined by a unique combination of soil components and/or miscellaneous areas in predictable proportions. Some components may be highly contrasting to the other components of the map unit. The presence of minor components in a map unit in no way diminishes the usefulness or accuracy of the data. The delineation of such landforms and landform segments on the map provides sufficient information for the development of resource plans. If intensive use of small areas is planned, onsite investigation is needed to define and locate the soils and miscellaneous areas. Soil scientists make many field observations in the process of producing a soil map. The frequency of observation is dependent upon several factors, including scale of mapping, intensity of mapping, design of map units, complexity of the landscape, and experience of the soil scientist. Observations are made to test and refine the soil-landscape model and predictions and to verify the classification of the soils at specific locations. Once the soil-landscape model is refined, a significantly smaller number of measurements of individual soil properties are made and recorded. These measurements may include field measurements, such as those for color, depth to bedrock, and texture, and laboratory measurements, such as those for content of sand, silt, clay, salt, and other components. Properties of each soil typically vary from one point to another across the landscape. Observations for map unit components are aggregated to develop ranges of characteristics for the components. The aggregated values are presented. Direct measurements do not exist for every property presented for every map unit component. Values for some properties are estimated from combinations of other properties. While a soil survey is in progress, samples of some of the soils in the area generally are collected for laboratory analyses and for engineering tests. Soil scientists interpret the data from these analyses and tests as well as the field-observed characteristics and the soil properties to determine the expected behavior of the soils under different uses. Interpretations for all of the soils are field tested through observation of the soils in different uses and under different levels of management. Some interpretations are modified to fit local conditions, and some new interpretations are developed to meet local needs. Data are assembled from other sources, such as research information, production records, and field experience of specialists. For example, data on crop yields under defined levels of management are assembled from farm records and from field or plot experiments on the same kinds of soil. Predictions about soil behavior are based not only on soil properties but also on such variables as climate and biological activity. Soil conditions are predictable over long periods of time, but they are not predictable from year to year. For example, soil scientists can predict with a fairly high degree of accuracy that a given soil will have a high water table within certain depths in most years, but they cannot predict that a high water table will always be at a specific level in the soil on a specific date. After soil scientists located and identified the significant natural bodies of soil in the survey area, they drew the boundaries of these bodies on aerial photographs and Custom Soil Resource Report 6 identified each as a specific map unit. Aerial photographs show trees, buildings, fields, roads, and rivers, all of which help in locating boundaries accurately. Custom Soil Resource Report 7 Soil Map The soil map section includes the soil map for the defined area of interest, a list of soil map units on the map and extent of each map unit, and cartographic symbols displayed on the map. Also presented are various metadata about data used to produce the map, and a description of each soil map unit. 8 9 Custom Soil Resource Report Soil Map 4690360469037046903804690390469040046904104690420469043046904404690360469037046903804690390469040046904104690420469043046904404690450694250 694260 694270 694280 694290 694300 694310 694250 694260 694270 694280 694290 694300 694310 42° 20' 31'' N 72° 38' 31'' W42° 20' 31'' N72° 38' 27'' W42° 20' 28'' N 72° 38' 31'' W42° 20' 28'' N 72° 38' 27'' WN Map projection: Web Mercator Corner coordinates: WGS84 Edge tics: UTM Zone 18N WGS84 0 20 40 80 120 Feet 0 5 10 20 30 Meters Map Scale: 1:468 if printed on A portrait (8.5" x 11") sheet. Soil Map may not be valid at this scale. MAP LEGEND MAP INFORMATION Area of Interest (AOI) Area of Interest (AOI) Soils Soil Map Unit Polygons Soil Map Unit Lines Soil Map Unit Points Special Point Features Blowout Borrow Pit Clay Spot Closed Depression Gravel Pit Gravelly Spot Landfill Lava Flow Marsh or swamp Mine or Quarry Miscellaneous Water Perennial Water Rock Outcrop Saline Spot Sandy Spot Severely Eroded Spot Sinkhole Slide or Slip Sodic Spot Spoil Area Stony Spot Very Stony Spot Wet Spot Other Special Line Features Water Features Streams and Canals Transportation Rails Interstate Highways US Routes Major Roads Local Roads Background Aerial Photography The soil surveys that comprise your AOI were mapped at 1:15,800. Warning: Soil Map may not be valid at this scale. Enlargement of maps beyond the scale of mapping can cause misunderstanding of the detail of mapping and accuracy of soil line placement. The maps do not show the small areas of contrasting soils that could have been shown at a more detailed scale. Please rely on the bar scale on each map sheet for map measurements. Source of Map: Natural Resources Conservation Service Web Soil Survey URL: Coordinate System: Web Mercator (EPSG:3857) Maps from the Web Soil Survey are based on the Web Mercator projection, which preserves direction and shape but distorts distance and area. A projection that preserves area, such as the Albers equal-area conic projection, should be used if more accurate calculations of distance or area are required. This product is generated from the USDA-NRCS certified data as of the version date(s) listed below. Soil Survey Area: Hampshire County, Massachusetts, Central Part Survey Area Data: Version 15, Jun 9, 2020 Soil map units are labeled (as space allows) for map scales 1:50,000 or larger. Date(s) aerial images were photographed: Sep 29, 2013—Oct 16, 2016 The orthophoto or other base map on which the soil lines were compiled and digitized probably differs from the background Custom Soil Resource Report 10 MAP LEGEND MAP INFORMATION imagery displayed on these maps. As a result, some minor shifting of map unit boundaries may be evident. Custom Soil Resource Report 11 Map Unit Legend Map Unit Symbol Map Unit Name Acres in AOI Percent of AOI 741A Amostown-Windsor silty substratum-Urban land complex, 0 to 3 percent slopes 0.5 100.0% Totals for Area of Interest 0.5 100.0% Map Unit Descriptions The map units delineated on the detailed soil maps in a soil survey represent the soils or miscellaneous areas in the survey area. The map unit descriptions, along with the maps, can be used to determine the composition and properties of a unit. A map unit delineation on a soil map represents an area dominated by one or more major kinds of soil or miscellaneous areas. A map unit is identified and named according to the taxonomic classification of the dominant soils. Within a taxonomic class there are precisely defined limits for the properties of the soils. On the landscape, however, the soils are natural phenomena, and they have the characteristic variability of all natural phenomena. Thus, the range of some observed properties may extend beyond the limits defined for a taxonomic class. Areas of soils of a single taxonomic class rarely, if ever, can be mapped without including areas of other taxonomic classes. Consequently, every map unit is made up of the soils or miscellaneous areas for which it is named and some minor components that belong to taxonomic classes other than those of the major soils. Most minor soils have properties similar to those of the dominant soil or soils in the map unit, and thus they do not affect use and management. These are called noncontrasting, or similar, components. They may or may not be mentioned in a particular map unit description. Other minor components, however, have properties and behavioral characteristics divergent enough to affect use or to require different management. These are called contrasting, or dissimilar, components. They generally are in small areas and could not be mapped separately because of the scale used. Some small areas of strongly contrasting soils or miscellaneous areas are identified by a special symbol on the maps. If included in the database for a given area, the contrasting minor components are identified in the map unit descriptions along with some characteristics of each. A few areas of minor components may not have been observed, and consequently they are not mentioned in the descriptions, especially where the pattern was so complex that it was impractical to make enough observations to identify all the soils and miscellaneous areas on the landscape. The presence of minor components in a map unit in no way diminishes the usefulness or accuracy of the data. The objective of mapping is not to delineate pure taxonomic classes but rather to separate the landscape into landforms or landform segments that have similar use and management requirements. The delineation of such segments on the map provides sufficient information for the development of resource plans. If intensive use of small areas is planned, however, Custom Soil Resource Report 12 onsite investigation is needed to define and locate the soils and miscellaneous areas. An identifying symbol precedes the map unit name in the map unit descriptions. Each description includes general facts about the unit and gives important soil properties and qualities. Soils that have profiles that are almost alike make up a soil series. Except for differences in texture of the surface layer, all the soils of a series have major horizons that are similar in composition, thickness, and arrangement. Soils of one series can differ in texture of the surface layer, slope, stoniness, salinity, degree of erosion, and other characteristics that affect their use. On the basis of such differences, a soil series is divided into soil phases. Most of the areas shown on the detailed soil maps are phases of soil series. The name of a soil phase commonly indicates a feature that affects use or management. For example, Alpha silt loam, 0 to 2 percent slopes, is a phase of the Alpha series. Some map units are made up of two or more major soils or miscellaneous areas. These map units are complexes, associations, or undifferentiated groups. A complex consists of two or more soils or miscellaneous areas in such an intricate pattern or in such small areas that they cannot be shown separately on the maps. The pattern and proportion of the soils or miscellaneous areas are somewhat similar in all areas. Alpha-Beta complex, 0 to 6 percent slopes, is an example. An association is made up of two or more geographically associated soils or miscellaneous areas that are shown as one unit on the maps. Because of present or anticipated uses of the map units in the survey area, it was not considered practical or necessary to map the soils or miscellaneous areas separately. The pattern and relative proportion of the soils or miscellaneous areas are somewhat similar. Alpha-Beta association, 0 to 2 percent slopes, is an example. An undifferentiated group is made up of two or more soils or miscellaneous areas that could be mapped individually but are mapped as one unit because similar interpretations can be made for use and management. The pattern and proportion of the soils or miscellaneous areas in a mapped area are not uniform. An area can be made up of only one of the major soils or miscellaneous areas, or it can be made up of all of them. Alpha and Beta soils, 0 to 2 percent slopes, is an example. Some surveys include miscellaneous areas. Such areas have little or no soil material and support little or no vegetation. Rock outcrop is an example. Custom Soil Resource Report 13 Hampshire County, Massachusetts, Central Part 741A—Amostown-Windsor silty substratum-Urban land complex, 0 to 3 percent slopes Map Unit Setting National map unit symbol: 99z2 Elevation: 100 to 330 feet Mean annual precipitation: 40 to 50 inches Mean annual air temperature: 45 to 52 degrees F Frost-free period: 120 to 240 days Farmland classification: Not prime farmland Map Unit Composition Amostown and similar soils:35 percent Windsor, silty substratum, and similar soils:25 percent Urban land:25 percent Minor components:15 percent Estimates are based on observations, descriptions, and transects of the mapunit. Description of Amostown Setting Landform:Deltas, outwash plains, terraces Landform position (two-dimensional):Summit, footslope Landform position (three-dimensional):Tread Down-slope shape:Convex Across-slope shape:Convex Parent material:Friable sandy glaciofluvial deposits over silty glaciolacustrine deposits Typical profile H1 - 0 to 7 inches: fine sandy loam H2 - 7 to 32 inches: fine sandy loam H3 - 32 to 60 inches: stratified very fine sand to silt loam Properties and qualities Slope:0 to 3 percent Depth to restrictive feature:More than 80 inches Drainage class:Moderately well drained Runoff class: Low Capacity of the most limiting layer to transmit water (Ksat):Moderately low to moderately high (0.06 to 0.60 in/hr) Depth to water table:About 18 to 36 inches Frequency of flooding:None Frequency of ponding:None Available water capacity:High (about 9.3 inches) Interpretive groups Land capability classification (irrigated): None specified Land capability classification (nonirrigated): 2w Hydrologic Soil Group: B Ecological site: F145XY005MA - Moist Lake Plain Hydric soil rating: No Custom Soil Resource Report 14 Description of Windsor, Silty Substratum Setting Landform:Outwash plains Landform position (two-dimensional):Footslope Landform position (three-dimensional):Tread Down-slope shape:Convex Across-slope shape:Convex Parent material:Loose sandy glaciofluvial deposits over silty glaciolacustrine deposits Typical profile H1 - 0 to 8 inches: loamy sand H2 - 8 to 21 inches: loamy sand H3 - 21 to 45 inches: sand H4 - 45 to 60 inches: silt loam Properties and qualities Slope:0 to 3 percent Depth to restrictive feature:More than 80 inches Drainage class:Somewhat excessively drained Runoff class: Very low Capacity of the most limiting layer to transmit water (Ksat):Moderately high (0.20 to 0.60 in/hr) Depth to water table:More than 80 inches Frequency of flooding:None Frequency of ponding:None Available water capacity:Low (about 5.6 inches) Interpretive groups Land capability classification (irrigated): None specified Land capability classification (nonirrigated): 3s Hydrologic Soil Group: A Ecological site: F144AY022MA - Dry Outwash Hydric soil rating: No Minor Components Enosburg Percent of map unit:10 percent Landform:Terraces Hydric soil rating: Yes Maybid Percent of map unit:5 percent Landform:Depressions Hydric soil rating: Yes Custom Soil Resource Report 15 References American Association of State Highway and Transportation Officials (AASHTO). 2004. Standard specifications for transportation materials and methods of sampling and testing. 24th edition. American Society for Testing and Materials (ASTM). 2005. Standard classification of soils for engineering purposes. ASTM Standard D2487-00. Cowardin, L.M., V. Carter, F.C. Golet, and E.T. LaRoe. 1979. Classification of wetlands and deep-water habitats of the United States. U.S. Fish and Wildlife Service FWS/OBS-79/31. Federal Register. July 13, 1994. Changes in hydric soils of the United States. Federal Register. September 18, 2002. Hydric soils of the United States. Hurt, G.W., and L.M. Vasilas, editors. Version 6.0, 2006. Field indicators of hydric soils in the United States. National Research Council. 1995. Wetlands: Characteristics and boundaries. Soil Survey Division Staff. 1993. Soil survey manual. Soil Conservation Service. U.S. Department of Agriculture Handbook 18. http://www.nrcs.usda.gov/wps/portal/ nrcs/detail/national/soils/?cid=nrcs142p2_054262 Soil Survey Staff. 1999. Soil taxonomy: A basic system of soil classification for making and interpreting soil surveys. 2nd edition. Natural Resources Conservation Service, U.S. Department of Agriculture Handbook 436. http:// www.nrcs.usda.gov/wps/portal/nrcs/detail/national/soils/?cid=nrcs142p2_053577 Soil Survey Staff. 2010. Keys to soil taxonomy. 11th edition. U.S. Department of Agriculture, Natural Resources Conservation Service. http:// www.nrcs.usda.gov/wps/portal/nrcs/detail/national/soils/?cid=nrcs142p2_053580 Tiner, R.W., Jr. 1985. Wetlands of Delaware. U.S. Fish and Wildlife Service and Delaware Department of Natural Resources and Environmental Control, Wetlands Section. United States Army Corps of Engineers, Environmental Laboratory. 1987. Corps of Engineers wetlands delineation manual. Waterways Experiment Station Technical Report Y-87-1. United States Department of Agriculture, Natural Resources Conservation Service. National forestry manual. http://www.nrcs.usda.gov/wps/portal/nrcs/detail/soils/ home/?cid=nrcs142p2_053374 United States Department of Agriculture, Natural Resources Conservation Service. National range and pasture handbook. http://www.nrcs.usda.gov/wps/portal/nrcs/ detail/national/landuse/rangepasture/?cid=stelprdb1043084 16 United States Department of Agriculture, Natural Resources Conservation Service. National soil survey handbook, title 430-VI. http://www.nrcs.usda.gov/wps/portal/ nrcs/detail/soils/scientists/?cid=nrcs142p2_054242 United States Department of Agriculture, Natural Resources Conservation Service. 2006. Land resource regions and major land resource areas of the United States, the Caribbean, and the Pacific Basin. U.S. Department of Agriculture Handbook 296. http://www.nrcs.usda.gov/wps/portal/nrcs/detail/national/soils/? cid=nrcs142p2_053624 United States Department of Agriculture, Soil Conservation Service. 1961. Land capability classification. U.S. Department of Agriculture Handbook 210. http:// www.nrcs.usda.gov/Internet/FSE_DOCUMENTS/nrcs142p2_052290.pdf Custom Soil Resource Report 17 Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix D APPENDIX D PRE- & POST-DEVELOPMENT DRAINAGE CALCULATIONS TSS CALCULATIONS Watershed Area (ac)Impervious (ac)Grass "B" CN Tc (min)E-1 0.51 0.45 0.06 95 6.0Total0.51 0.45 0.06 95.0 -Existing Watershed Cover CharacteristicsBig Y NorthamptonProject # 70443.04 Watershed Area (ac)Impervious (ac)Grass "B" CN Tc (min)P-1 0.51 0.45 0.06 95 6.0Total0.51 0.45 0.06 95.0 -Proposed Watershed Cover CharacteristicsBig Y NorthamptonProject # 70443.04 Type III 24-hr 25-Year Rainfall=6.05"70443.04_Proposed Printed 1/11/2021Prepared by {enter your company name here} Page 2HydroCAD® 10.00-22 s/n 06318 © 2018 HydroCAD Software Solutions LLC Pond 2P: (new Pond) - Chamber Wizard Field A Chamber Model = ADS_StormTech SC-740 +Cap (ADS StormTech® SC-740 with cap length) Effective Size= 44.6"W x 30.0"H => 6.45 sf x 7.12'L = 45.9 cf Overall Size= 51.0"W x 30.0"H x 7.56'L with 0.44' Overlap 51.0" Wide + 6.0" Spacing = 57.0" C-C Row Spacing 2 Chambers/Row x 7.12' Long +0.81' Cap Length x 2 = 15.86' Row Length +12.0" End Stone x 2 = 17.86' Base Length 3 Rows x 51.0" Wide + 6.0" Spacing x 2 + 12.0" Side Stone x 2 = 15.75' Base Width 12.0" Base + 30.0" Chamber Height + 6.0" Cover = 4.00' Field Height 6 Chambers x 45.9 cf = 275.6 cf Chamber Storage 1,125.0 cf Field - 275.6 cf Chambers = 849.3 cf Stone x 40.0% Voids = 339.7 cf Stone Storage Chamber Storage + Stone Storage = 615.4 cf = 0.014 af Overall Storage Efficiency = 54.7% Overall System Size = 17.86' x 15.75' x 4.00' 6 Chambers 41.7 cy Field 31.5 cy Stone INSTRUCTIONS:Version 1, Automated: Mar. 4, 20081. In BMP Column, click on Blue Cell to Activate Drop Down Menu2. Select BMP from Drop Down Menu3. After BMP is selected, TSS Removal and other Columns are automatically completed.Location: B C D E FTSS Removal Starting TSS Amount RemainingBMP1Rate1Load* Removed (C*D) Load (D-E)Street Sweeping - 5% 0.05 1.00 0.05 0.95Proprietary Treatment Practice0.50 0.95 0.48 0.48Leaching Catch Basin 0.80 0.48 0.38 0.10Total TSS Removal =91%Project:70443.04 Big Y ExpressPrepared By:JCO*Equals remaining load from previous BMP (E)Date:1/11/2021which enters the BMPBig Y Express, Northampton, MATSS Removal Calculation 1 PHILIP D. MURPHY DEPARTMENT OF ENVIRONMENTAL PROTECTION CATHERINE R. MCCABE Governor Mail Code – 401-02B Acting Commissioner Division of Water Quality Bureau of Nonpoint Pollution Control SHEILA Y. OLIVER P.O. Box 420 – 401 E. State St. Lt. Governor Trenton, NJ 08625-0420 Phone: (609) 633-7021 / Fax: (609) 777-0432 http://www.state.nj.us/dep/dwq/bnpc_home.htm March 27, 2018 Graham Bryant, M.Sc., P.E. President Hydroworks, LLC 136 Central Avenue Clark, NJ 07066 Re: MTD Lab Certification HydroStorm Hydrodynamic Separator by Hydroworks, LLC Online Installation TSS Removal Rate 50% Dear Mr. Bryant: The Stormwater Management rules under N.J.A.C. 7:8-5.5(b) and 5.7 (c) allow the use of manufactured treatment devices (MTDs) for compliance with the design and performance standards at N.J.A.C. 7:8-5 if the pollutant removal rates have been verified by the New Jersey Corporation for Advanced Technology (NJCAT) and have been certified by the New Jersey Department of Environmental Protection (NJDEP). Hydroworks, LLC has requested an MTD Laboratory Certification for the Hydroworks HydroStorm Hydrodynamic Separator. The project falls under the “Procedure for Obtaining Verification of a Stormwater Manufactured Treatment Device from New Jersey Corporation for Advance Technology” dated January 25, 2013. The applicable protocol is the “New Jersey Laboratory Testing Protocol to Assess Total Suspended Solids Removal by a Hydrodynamic Sedimentation Manufactured Treatment Device” dated January 25, 2013. NJCAT verification documents submitted to the NJDEP indicate that the requirements of the aforementioned protocol have been met or exceeded. The NJCAT letter also included a recommended certification TSS removal rate and the required maintenance plan. The NJCAT Verification Report with the Verification Appendix (dated February 2018) for this device is published online at http://www.njcat.org/verification-process/technology-verification-database.html. The NJDEP certifies the use of the HydroStorm by Hydroworks, LLC at a TSS removal rate of 50% when designed, operated, and maintained in accordance with the information provided in the Verification Appendix and the following conditions: New Jersey is an Equal Opportunity Employer Printed on Recycled Paper and Recyclable 2 1. The maximum treatment flow rate (MTFR) for the manufactured treatment device (MTD) is calculated using the New Jersey Water Quality Design Storm (1.25 inches in 2 hrs) in N.J.A.C. 7:8-5.5. 2. The HydroStorm shall be installed using the same configuration reviewed by NJCAT and shall be sized in accordance with the criteria specified in item 6 below. 3. This HydroStorm cannot be used in series with another MTD or a media filter (such as a sand filter) to achieve an enhanced removal rate for total suspended solids (TSS) removal under N.J.A.C. 7:8-5.5. 4. Additional design criteria for MTDs can be found in Chapter 9.6 of the New Jersey Stormwater Best Management Practices (NJ Stormwater BMP) Manual, which can be found online at www.njstormwater.org. 5. The maintenance plan for a site using this device shall incorporate, at a minimum, the maintenance requirements for the Hydrostorm. A copy of the maintenance plan is attached to this certification. However, it is recommended to review the maintenance website at http://www.hydroworks.com/hydrostormo&m.pdf for any changes to the maintenance requirements. 6. Sizing Requirement: The example below demonstrates the sizing procedure for the Hydrostorm: Example: A 0.25-acre impervious site is to be treated to 50% TSS removal using a HydroStorm. The impervious site runoff (Q) based on the New Jersey Water Quality Design Storm was determined to be 0.79 cfs. Maximum Treatment Flow Rate (MTFR) Evaluation: The site runoff (Q) was based on the following: time of concentration = 10 minutes i = 3.2 in/hr (page 5-8, Fig. 5-3 of the NJ Stormwater BMP Manual) c = 0.99 (runoff coefficient for impervious) Q = ciA = 0.99 x 3.2 x 0.25 = 0.79 cfs Given the site runoff is 0.79 cfs and based on Table 1 below, the HydroStorm Model HS4 with a MTFR of 0.88 cfs could be used for this site to remove 50% of the TSS from the impervious area without exceeding the MTFR. The sizing table corresponding to the available system models is noted below. Additional specifications regarding each model can be found in the Verification Appendix under Table A-1. 3 Table 1 HydroStorm Sizing Information HydroStorm Model NJDEP 50% TSS Maximum Treatment Flow Rate (cfs) Treatment Area (ft2) Hydraulic Loading Rate (gpm/ft2) 50% Maximum Sediment Storage (ft3) HS3 0.50 7.1 31.4 3.6 HS4 0.88 12.6 31.4 6.3 HS5 1.37 19.6 31.4 9.8 HS6 1.98 28.3 31.4 14.2 HS7 2.69 38.5 31.4 19.3 HS8 3.52 50.3 31.4 25.2 HS9 4.45 63.6 31.4 31.8 HS10 5.49 78.5 31.4 39.3 HS11 6.65 95.0 31.4 47.5 HS12 7.91 113.0 31.4 56.5 A detailed maintenance plan is mandatory for any project with a Stormwater BMP subject to the Stormwater Management Rules, N.J.A.C. 7:8. The plan must include all of the items identified in the Stormwater Management Rules, N.J.A.C. 7:8-5.8. Such items include, but are not limited to, the list of inspection and maintenance equipment and tools, specific corrective and preventative maintenance tasks, indication of problems in the system, and training of maintenance personnel. Additional information can be found in Chapter 8: Maintenance and Retrofit of Stormwater Management Measures. If you have any questions regarding the above information, please contact Brian Salvo or Nick Grotts of my office at (609) 633-7021. Sincerely, James J. Murphy, Chief Bureau of Nonpoint Pollution Control Attachment: Maintenance Plan cc: Chron File Richard Magee, NJCAT Vince Mazzei, NJDEP - DLUR Ravi Patraju, NJDEP - BES Gabriel Mahon, NJDEP - BNPC Brian Salvo, NJDEP – BNPC Nick Grotts, NJDEP – BNPC Please call Hydroworks at 888-290-7900 or email us at support@hydroworks.com if you have any questions regarding the Inspection Checklist. Please fax a copy of the completed checklist to Hydroworks at 888-783-7271 for our records. Hydroworks® HydroStorm Operations & Maintenance Manual Version 1.0 Introduction The HydroStorm is a state of the art hydrodynamic separator. Hydrodynamic separators remove solids, debris and lighter than water (oil, trash, floating debris) pollutants from stormwater. Hydrodynamic separators and other water quality measures are mandated by regulatory agencies (Town/City, State, Federal Government) to protect storm water quality from pollution generated by urban development (traffic, people) as part of new development permitting requirements. As storm water treatment structures fill up with pollutants they become less and less effective in removing new pollution. Therefore, it is important that storm water treatment structures be maintained on a regular basis to ensure that they are operating at optimum performance. The HydroStorm is no different in this regard and this manual has been assembled to provide the owner/operator with the necessary information to inspect and coordinate maintenance of their HydroStorm. Hydroworks® HydroStorm Operation The Hydroworks HydroStorm (HS) separator is a unique hydrodynamic by-pass separator. It incorporates a protected submerged pretreatment zone to collect larger solids, a treatment tank to remove finer solids, and a dual set of weirs to create a high flow bypass. High flows are conveyed directly to the outlet and do not enter the treatment area, however, the submerged pretreatment area still allows removal of coarse solids during high flows. Under normal or low flows, water enters an inlet area with a horizontal grate. The area underneath the grate is submerged with openings to the main treatment area of the separator. Coarse solids fall through the grate and are either trapped in the pretreatment area or conveyed into the main treatment area depending on the flow rate. Fines are transported into the main treatment area. Openings and weirs in the pretreatment area allow entry of water and solids into the main treatment area and cause water to rotate in the main treatment area creating a vortex motion. Water in the main treatment area is forced to rise along the walls of the separator to discharge from the treatment area to the downstream pipe. The vortex motion forces solids and floatables to the middle of the inner chamber. Floatables are trapped since the inlet to the treatment area is submerged. The design maximizes the retention of settled solids since solids are forced to the center of the inner chamber by the vortex motion of water while water must flow up the walls of the separator to discharge into the downstream pipe. A set of high flow weirs near the outlet pipe create a high flow bypass over both the pretreatment area and main treatment chamber. The rate of flow into the treatment area is regulated by the number and size of openings into the treatment chamber and the height of by-pass weirs. High flows flow over the weirs directly to the outlet pipe preventing the scour and resuspension of any fines collected in the treatment chamber. A central access tube is located in the structure to provide access for cleaning. The arrangement of the inlet area and bypass weirs near the outlet pipe facilitate the use of multiple inlet pipes. Figure 1. Hydroworks HydroStorm Operation – Plan View Figure 2 is a profile view of the HydroStorm separator showing the flow patterns for low and high flows. Figure 2. Hydroworks HydroStorm Operation – Profile View The HS 4i is an inlet version of the HS 4 separator. There is a catch-basin grate on top of the HS 4i. A funnel sits sits underneath the grate on the frame and directs the water to the inlet side of the separator to ensure all lows flows are properly treated. The whole funnel is removed for inspection and cleaning. Figure 3. Hydroworks HS 4i Funnel Inspection Procedure Floatables A visual inspection can be conducted for floatables by removing the covers and looking down into the center access tube of the separator. Separators with an inlet grate (HS 4i or custom separator) will have a plastic funnel located under the grate that must be removed from the frame prior to inspection or maintenance. If you are missing a funnel please contact Hydroworks at the numbers provided at the end of this document. TSS/Sediment Inspection for TSS build-up can be conducted using a Sludge Judge®, Core Pro®, AccuSludge® or equivalent sampling device that allows the measurement of the depth of TSS/sediment in the unit. These devices typically have a ball valve at the bottom of the tube that allows water and TSS to flow into the tube when lowering the tube into the unit. Once the unit touches the bottom of the device, it is quickly pulled upward such that the water and TSS in the tube forces the ball valve closed allowing the user to see a full core of water/TSS in the unit. The unit should be inspected for TSS through each of the access covers. Several readings (2 or 3) should be made at each access cover to ensure that an accurate TSS depth measurement is recorded. Frequency Construction Period The HydroStorm separator should be inspected every four weeks and after every large storm (over 0.5” (12.5 mm) of rain) during the construction period. Post-Construction Period The Hydroworks HydroStorm separator should be inspected during the first year of operation for normal stabilized sites (grassed or paved areas). If the unit is subject to oil spills or runoff from unstabilized (storage piles, exposed soils) areas the HydroStorm separator should be inspected more frequently (4 times per year). The initial annual inspection will indicate the required future frequency of inspection and maintenance if the unit was maintained after the construction period. Reporting Reports should be prepared as part of each inspection and include the following information: 1. Date of inspection 2. GPS coordinates of Hydroworks unit 3. Time since last rainfall 4. Date of last inspection 5. Installation deficiencies (missing parts, incorrect installation of parts) 6. Structural deficiencies (concrete cracks, broken parts) 7. Operational deficiencies (leaks, blockages) 8. Presence of oil sheen or depth of oil layer 9. Estimate of depth/volume of floatables (trash, leaves) captured 10. Sediment depth measured 11. Recommendations for any repairs and/or maintenance for the unit 12. Estimation of time before maintenance is required if not required at time of inspection A sample inspection checklist is provided at the end of this manual. Maintenance Procedure The Hydroworks HydroStorm unit is typically maintained using a vacuum truck. There are numerous companies that can maintain the HydroStorm separator. Maintenance with a vacuum truck involves removing all of the water and sediment together. The water is then separated from the sediment on the truck or at the disposal facility. A central access opening (24” or greater) is provided to the gain access to the lower treatment tank of the unit. This is the primary location to maintain by vacuum truck. The pretreatment area can also be vacuumed and/or flushed into the lower treatment tank of the separator for cleaning via the central access once the water level is lowered below the pretreatment floor. In instances where a vacuum truck is not available other maintenance methods (i.e. clamshell bucket) can be used, but they will be less effective. If a clamshell bucket is used the water must be decanted prior to cleaning since the sediment is under water and typically fine in nature. Disposal of the water will depend on local requirements. Disposal options for the decanted water may include: 1. Discharge into a nearby sanitary sewer manhole 2. Discharge into a nearby LID practice (grassed swale, bioretention) 3. Discharge through a filter bag into a downstream storm drain connection The local municipality should be consulted for the allowable disposal options for both water and sediments prior to any maintenance operation. Once the water is decanted the sediment can be removed with the clamshell bucket. Disposal of the contents of the separator depend on local requirements. Maintenance of a Hydroworks HydroStorm unit will typically take 1 to 2 hours based on a vacuum truck and longer for other cleaning methods (i.e. clamshell bucket). Figure 3. Maintenance Access Frequency Construction Period A HydroStorm separator can fill with construction sediment quickly during the construction period. The HydroStorm must be maintained during the construction period when the depth of TSS/sediment reaches 24” (600 mm). It must also be maintained during the construction period if there is an appreciable depth of oil in the unit (more than a sheen) or if floatables other than oil cover over 50% of the area of the separator The HydroStorm separator should be maintained at the end of the construction period, prior to operation for the post-construction period. Post-Construction Period The HydroStorm was independently tested by Alden Research Laboratory in 2017. A HydroStorm HS 4 was tested for scour with a 50% sediment depth of 0.5 ft. Therefore, maintenance for sediment accumulation is required if the depth of sediment is 1 ft or greater in separators with standard water (sump) depths (Table 1). There will be designs with increased sediment storage based on specifications or site-specific criteria. A measurement of the total water depth in the separator through the central access tube should be taken and compared to water depth given in Table 1. The standard water depth from Table 1 should be subtracted from the measured water depth and the resulting extra depth should be added to the 1 ft to determine the site-specific sediment maintenance depth for that separator. For example, if the measured water depth in the HS-7 is 7 feet, then the sediment maintenance depth for that HS-7 is 2 ft (= 1 + 7 – 6) and the separator does not need to be cleaned for sediment accumulation until the measure sediment depth is 2 ft. The HydroStorm separator must also be maintained if there is an appreciable depth of oil in the unit (more than a sheen) or if floatables other than oil cover over 50% of the water surface of the separator. Table 1 Standard Dimensions for Hydroworks HydroStorm Models Model Diameter (ft) Total Water Depth (ft) Sediment Maintenance Depth for Table 1 Total Water Depth(ft) HS-3 3 3 1 HS-4 4 4 1 HS-5 5 4 1 HS-6 6 4 1 HS-7 7 6 1 HS-8 8 7 1 HS-9 9 7.5 1 HS-10 10 8 1 HS-11 11 9 1 HS-12 12 9.5 1 HYDROSTORM INSPECTION SHEET Date Date of Last Inspection Site City State Owner GPS Coordinates Date of last rainfall Site Characteristics Yes No Soil erosion evident Exposed material storage on site Large exposure to leaf litter (lots of trees) High traffic (vehicle) area HydroStorm Yes No Obstructions in the inlet or outlet * Missing internal components ** Improperly installed inlet or outlet pipes *** Internal component damage (cracked, broken, loose pieces) ** Floating debris in the separator (oil, leaves, trash) Large debris visible in the separator * Concrete cracks/deficiencies *** Exposed rebar ** Water seepage (water level not at outlet pipe invert) *** Water level depth below outlet pipe invert “ Routine Measurements Floating debris depth < 0.5” (13mm) >0.5” 13mm) * Floating debris coverage < 50% of surface area > 50% surface area * Sludge depth < 12” (300mm) > 12” (300mm) * * Maintenance required ** Repairs required *** Further investigation is required Other Comments: Hydroworks® HydroStorm One Year Limited Warranty Hydroworks, LLC warrants, to the purchaser and subsequent owner(s) during the warranty period subject to the terms and conditions hereof, the Hydroworks HydroStorm to be free from defects in material and workmanship under normal use and service, when properly installed, used, inspected and maintained in accordance with Hydroworks written instructions, for the period of the warranty. The standard warranty period is 1 year. The warranty period begins once the separator has been manufactured and is available for delivery. Any components determined to be defective, either by failure or by inspection, in material and workmanship will be repaired, replaced or remanufactured at Hydroworks’ option provided, however, that by doing so Hydroworks, LLC will not be obligated to replace an entire insert or concrete section, or the complete unit. This warranty does not cover shipping charges, damages, labor, any costs incurred to obtain access to the unit, any costs to repair/replace any surface treatment/cover after repair/replacement, or other charges that may occur due to product failure, repair or replacement. This warranty does not apply to any material that has been disassembled or modified without prior approval of Hydroworks, LLC, that has been subjected to misuse, misapplication, neglect, alteration, accident or act of God, or that has not been installed, inspected, operated or maintained in accordance with Hydroworks, LLC instructions and is in lieu of all other warranties expressed or implied. Hydroworks, LLC does not authorize any representative or other person to expand or otherwise modify this limited warranty. The owner shall provide Hydroworks, LLC with written notice of any alleged defect in material or workmanship including a detailed description of the alleged defect upon discovery of the defect. Hydroworks, LLC should be contacted at 136 Central Ave., Clark, NJ 07066 or any other address as supplied by Hydroworks, LLC. (888-290-7900). This limited warranty is exclusive. There are no other warranties, express or implied, or merchantability or fitness for a particular purpose and none shall be created whether under the uniform commercial code, custom or usage in the industry or the course of dealings between the parties. Hydroworks, LLC will replace any goods that are defective under this warranty as the sole and exclusive remedy for breach of this warranty. Subject to the foregoing, all conditions, warranties, terms, undertakings or liabilities (including liability as to negligence), expressed or implied, and howsoever arising, as to the condition, suitability, fitness, safety, or title to the Hydroworks HydroStorm are hereby negated and excluded and Hydroworks, LLC gives and makes no such representation, warranty or undertaking except as expressly set forth herein. Under no circumstances shall Hydroworks, LLC be liable to the Purchaser or to any third party for product liability claims; claims arising from the design, shipment, or installation of the HydroStorm, or the cost of other goods or services related to the purchase and installation of the HydroStorm. For this Limited Warranty to apply, the HydroStorm must be installed in accordance with all site conditions required by state and local codes; all other applicable laws; and Hydroworks’ written installation instructions. Hydroworks, LLC expressly disclaims liability for special, consequential or incidental damages (even if it has been advised of the possibility of the same) or breach of expressed or implied warranty. Hydroworks, LLC shall not be liable for penalties or liquidated damages, including loss of production and profits; labor and materials; overhead costs; or other loss or expense incurred by the purchaser or any third party. Specifically excluded from limited warranty coverage are damages to the HydroStorm arising from ordinary wear and tear; alteration, accident, misuse, abuse or neglect; improper maintenance, failure of the product due to improper installation of the concrete sections or improper sizing; or any other event not caused by Hydroworks, LLC. This limited warranty represents Hydroworks’ sole liability to the purchaser for claims related to the HydroStorm, whether the claim is based upon contract, tort, or other legal basis. Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix E APPENDIX E STORMWATER MANAGEMENT SYSTEM LONG TERM O&M PLAN Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 0 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan January 2021 Prepared for: Big Y - Site Redevelopment 2145 Roosevelt Avenue PO Box 7840 Springfield, MA 01102 Prepared by: Alfred Benesch & Company 120 Hebron Avenue, Floor 2, Glastonbury, CT 06033 Copyright 2019, of Alfred Benesch & Company. All rights reserved. This plan and design content is the property of Alfred Benesch & Company. Use, reuse, reproduction or modification of this plan or design information, or any part thereof, is strictly prohibited, except by written permission of this firm. Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 1 (This page left intentionally blank.) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 2 TABLE OF CONTENTS 1 RESPONSIBLE PARTY ................................................................................................ 4 1.1 Stormwater Management System(s) Owners ................................................................... 4 1.2 Operation and Maintenance ............................................................................................. 4 2 STRUCTURAL STORMWATER BMP MAINTENANCE .................................................... 5 2.1 Structural Stormwater BMP Maintenance Schedule ........................................................ 5 2.2 Methods ............................................................................................................................ 5 2.2.1 Proprietary Separators ........................................................................................................ 5 2.2.2 Subsurface Structure ......................................................................................................... 18 3 INSPECTIONS AND RECORDKEEPING ....................................................................... 22 4 LONG-TERM POLLUTION PLAN ............................................................................... 26 4.1 Preventative Measures ................................................................................................... 26 4.1.1 Customer Awareness ........................................................................................................ 26 4.1.2 Keeping the Action Plan On-Hand ..................................................................................... 26 4.1.3 Training Workers & Designating Roles ............................................................................. 26 4.1.4 Spill Kits ............................................................................................................................. 26 4.2 Hazardous Material Inventory ........................................................................................ 30 4.3 Waste and Wastewater Inventory .................................................................................. 30 4.4 Potential Pollution Sources and Protection Measures ................................................... 31 4.5 Pollution Prevention Apparatuses .................................................................................. 31 4.5.1 Positive Limiting Barriers .................................................................................................. 31 4.5.2 Proprietary Separators ...................................................................................................... 31 4.5.3 Oil and Grit Separator ....................................................................................................... 32 4.5.4 Subsurface Structures ....................................................................................................... 32 4.6 Spillage Action Plan ......................................................................................................... 32 4.6.1 Use Emergency Shut-offs .................................................................................................. 32 TABLE OF CONTENTS Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 3 4.6.2 Inform Management, Local and State Agencies ............................................................... 33 4.6.3 Controlled Clean-up in Stormwater Apparatuses.............................................................. 34 4.6.4 Disposal of Waste Material ............................................................................................... 34 4.7 Record Keeping ............................................................................................................... 34 4.7.1 List of Significant (> 5 gallons) Spills and Leaks ................................................................ 34 4.7.2 Inspections ........................................................................................................................ 35 4.7.3 Site Plan ............................................................................................................................ 38 5 ANNUAL OPERATION & MAINTENANCE BUDGET REQUIREMENT ............................. 38 ATTACHMENTS: MASSDEP MOSPRA OIL SPILL TRAILER LOCATIONS MASSDEP OIL SPILL RESPONSE TRAILER & DEPLOYMENT STANDARD OPERATING PROCEDURE Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 4 1 RESPONSIBLE PARTY The complexity and goals of these stormwater systems vary with the nature of the receiving water as well as the type of development proposed. In general, stormwater runoff from developed areas contains several pollutants which can have an adverse effect on downstream waters. Stormwater management systems that are properly installed and maintained can significantly decrease the non-point discharge from developed areas. The purpose of this Storm Water Management System Operation and Maintenance Plan is to prevent erosion, sedimentation, pollution or other deterioration of the storm water management system and resource areas located on and adjacent to the site property located at 136 North King Street, Northampton, MA 01060 (the “Site”). 1.1 Stormwater Management System(s) Owners Site Owner: Big Y 1.2 Operation and Maintenance To ensure compliance with Standard 9 of the Massachusetts Stormwater Management Standards, the Order of Conditions should include the continuing conditions: 1. All stormwater BMPs shall be operated and maintained in accordance with the design plans and the Operation and Maintenance Plan approved by the issuing authority. 2. The responsible party shall: a. Prepare and submit an “Operation and Maintenance (O & M) Compliance Statement” upon completion of site construction activities. b. Implement the routine and non-routine operation, maintenance, and inspection tasks in accordance with the procedures specified in this document to ensure that all storm water management systems function as designed; c. Maintain an operation and maintenance log for the last three years, including inspections, repairs, replacement and disposal (for disposal, the log shall indicate the type of material and the disposal location); d. Make this log available to the City of Northampton, MassDEP and the Conservation Commission upon request; and e. Allow members and agents of the City of Northampton, MassDEP and the Conservation Commission to enter and inspect the premises to evaluate and ensure that the responsible party complies with the Operation and Maintenance Plan requirements for each BMP. Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 5 2 STRUCTURAL STORMWATER BMP MAINTENANCE 2.1 Structural Stormwater BMP Maintenance Schedule 2.2 Methods 2.2.1 Proprietary Separators Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 6 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 7 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 8 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 9 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 10 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 11 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 12 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 13 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 14 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 15 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 16 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 17 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 18 2.2.2 Subsurface Structure Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 19 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 20 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 21 Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 22 3 INSPECTIONS AND RECORDKEEPING Routine Inspections: Routine inspections and maintenance to be conducted with the frequency described in this Operation and Maintenance Plan. Maintain an operation and maintenance log for the last three years, including inspections, repairs, replacement and disposal (for disposal, the log shall indicate the type of material and the disposal location). (See Stormwater Bmp Inspection and Maintenance Report Form) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 23 (This page left intentionally blank.) Long-Term Operation & Maintenance (O&M) Plan Big Y Kiosk and Gas Station Redevelopment – 136 North King Street, Northampton, MA STORMWATER BMP INSPECTION AND MAINTENANCE REPORT FORM Bi-Annual (Spring / Fall) Note: This Log should be copied prior to use. Note Additional Comments on back of Form. Inspector’s Name: ___________________________ Date: ______________ Time: __________am/pm Inspector’s Qualifications: ___________________________________________________________________ Days Since Last Rainfall: ____________ Amount of Last Rainfall: ___________inches Item/Condition to be Checked Maintenance Required Corrective Action & Date No Yes Proprietary Separators Subsurface Structures Leaching Catch Basins Landscaping / Trash Removal Snow Removal (seasonal) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 25 Long-Term Operation & Maintenance (O&M) Plan Big Y Kiosk and Gas Station Redevelopment – 136 North King Street, Northampton, MA Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 26 4 LONG-TERM POLLUTION PLAN Gasoline service stations area engaged in selling gasoline and lubricating oils. These establishments often sell other merchandise, such as tires, batteries, and other automobile parts. The gasoline station has an additional building onsite for the kiosk. Fuel is a complex mixture of chemicals, several of them toxic and carcinogenic. Types of chemicals or hazardous liquids used include but, are not limited to: gasoline formulations which include benzene, toluene, ethylbenzene, and xylene (BTEX). 4.1 Preventative Measures 4.1.1 Customer Awareness Signs should also be posted at the pump instructing customers not to top off fuel tanks and to notify an employee in the event of a spill. Each UST facility must have signage posted that provides emergency response information. Emergency signs must be visible to anyone dispensing or delivering fuel. Sign(s) should be installed prominently on the building nearest the dispensers. A minimum of one sign is required per facility, but if it cannot be easily located due to the size of the facility, it is advisable to post extra signs. Emergency shutoff switches should be plainly labeled. 4.1.2 Keeping the Action Plan On-Hand A copy of the complete description of Long-Term Pollution Plan for the facility shall be readily available for employees to act. Review them with your workers and the janitorial staff. Keep several copies around the store and let everyone know where they are located. A summary of the plan should be written and posted at appropriate points in the building, identifying the spill cleanup coordinators, location of cleanup kits, and phone numbers of regulatory agencies to be contacted in the event of a spill. 4.1.3 Training Workers & Designating Roles Educating workers is the most important part of the spill plan. Proper training can reduce the risk of worker injury and help reduce the impacts of any spill. By federal regulations it is required that refresher training should be provided at least every three years, and more often if necessary, to each employee operating a process in order to ensure that the employee understands and adheres to the current operating procedures. The owner should identify workers for spill response team and a worker that will call emergency contacts. (See Employee Training Form) 4.1.4 Spill Kits There should be a spill kit within 25 feet of all fueling stations. Spill kits should include: absorbent pads, storm drain plug, a non-water boom ten feet or more with a capacity of 12 gallons, and a non-metallic shovel. Kits should be deployed in a manner that allows rapid access and use by employees. The kits shall be maintained in good condition. Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 27 (This page left intentionally blank.) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 28 Long-Term Pollution Plan Big Y Kiosk and Gas Station Redevelopment – 136 North King Street, Northampton, MA EMPLOYEE TRAINING FORM It is the responsibility of the facility operator to ensure that employees are trained in materials management. All employees will be trained annually, and new hires will be trained within 30 days of starting. Training logs will be kept. Training Date: ___________________________________________________________ Trainer Name/Title: ________________________________________________________ Topics Covered: ( all applicable)  Purpose and requirements of the Long-Term Pollution  Employees responsibilities  Facility site plan and location of all hazardous materials  Proper waste collection and disposal procedures of materials  Spill prevention and response procedures and equipment  Good housekeeping practices and preventive maintenance  Reporting procedures  Other measures and controls Employees in attendance: PRINT NAME SIGN NAME Comments: ______________________________________________________________________ _______________________________________________________________________________ ______________________________________________________________________________ Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 29 (This page left intentionally blank.) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 30 4.2 Hazardous Material Inventory Below is a list of hazardous materials that are handled or stored on site including: raw materials, intermediate products, final products and other materials. These materials that could potentially pollute ground water: Hazardous Material Type Purpose / Description Location Container Type Container Size Maximum Quantity Stored Regular gasoline Retail Sales Underground tanks southeast of building Double wall fiberglass tanks 2 – 20,000 Gallons 19,000 Gallons (95% of capacity) Premium gasoline Retail Sales Underground tanks southeast of building Double wall fiberglass tank 1 – 12,000 Gallons 11,400 Gallons (95% of capacity) Diesel Fuel Retail Sales Underground tanks southeast of building Double wall fiberglass tanks 1 – 8,000 Gallons 7,600 Gallons (95% of capacity) 4.3 Waste and Wastewater Inventory Below is a list of all types and volumes of hazardous and solid wastes and wastewaters generated, and a description of how wastes are handled, stored and disposed: Waste and Wastewater Purpose / Description Location Quantity Stored / Generated Disposal Method Gasoline and/or Diesel fuel combined with water UST fill sump maintenance & spill response Dumpster area 1-55 gallon DOT drum Licensed waste hauler to licensed disposal facility Spent sorbents Spill response Dumpster area 1-55 gallon DOT drum Licensed waste hauler to licensed disposal facility Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 31 4.4 Potential Pollution Sources and Protection Measures The following measures and controls are used to prevent and abate any releases or spills which could cause pollution of the aquifer including design structures and controls, procedures, good housekeeping and preventive maintenance: Potential Pollution Source Control/Protection Measures Future Preventive Practices UST filling area Concrete spill pad, spill response procedures and materials, fill port spill containment sumps No changes planned at present Fuel dispensing area Concrete spill pad, spill response procedures – small spills to be remedied by staff with onsite materials, larger spills will contact fire department No changes planned at present Drum storage area Concrete spill pad Drum Storage Locker No changes planned at present Underground fuel storage tanks Double wall construction, continuous monitoring of annular space, electronic tank monitoring supplemented by manual tank gauging and weekly reconciliation. Periodic testing as required by law. Continued compliance with regulations and industry best practices for underground storage facilities. 4.5 Pollution Prevention Apparatuses 4.5.1 Positive Limiting Barriers In the event of a small spillage, the concrete pad underneath fueling stations has a positive limiting barrier (PLB) around the exterior edges of the pad. PLBs are 4 – ¾” concentric groves around the exterior of the pad. They are designed to contain five gallons of fuel per each dispenser and nozzles may not extend beyond the PLB barrier. 4.5.2 Proprietary Separators In event that the PLBs could not contain the spill, the oil pollutants may sheet flow to the catch basins on-site. Inside the catch basins, Hydroworks HydroStorm© HS4i inserts are installed inside the basins. It includes a protected pretreatment zone to collect larger solids that is submerged, a treatment container to eliminate finer solids, and a double set of weirs to produce a high flow bypass. High flows are carried directly to the outlet and do not go in the treatment zone, however, the submerged pretreatment area still allows removal of coarse solids during high flows. A funnel sits beneath the catch basin on the frame and guides the water to the inlet side of the separator to guarantee all lows flows are correctly treated. The entire funnel is taken out for examination and cleaning. To understand more about this proprietary Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 32 separator, see section 2.1 Structural Stormwater BMP Maintenance Schedule under Proprietary Separator. 4.5.3 Oil and Grit Separator If contaminants were to exceed the maximum spill volume of the Hydroworks HydroStorm© HS4i, they would continue into the stormwater system and they would enter the oil and grit separator. In this device, stormwater with sediments or contaminants enter the first chamber. Sediments settle to the bottom of the device and oils float to the top. Water can flow into the second chamber that is free of oil pollutants and debris. 4.5.4 Subsurface Structures 4.6 Spillage Action Plan 4.6.1 Use Emergency Shut-offs Operator maintains control of all dispensing activities through the point of sale control console. An emergency stop button at the operator’s station allows the operator to shut down all dispensing activities onsite in case of spill/emergency. The operator shall initiate the stop button once they have been alerted there has been a spill. Fence off effected area while cleaning spill if possible. Cleanup of spills should begin immediately. No emulsifier or dispersant should be used. Clean up methods should be dictated by the chemicals released with primary concern for human health. Dry clean-up methods should be used for oil spills. Material Safety Data Sheets (MSDS) should be at the gasoline reconciliation binder as a suitable information source for appropriate clean-up of chemicals. Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 33 4.6.2 Inform Management, Local and State Agencies Be prepared with the following information: · Name, organization, and telephone number · Name and address of the party responsible for the incident · Date and time of the incident · Location of the incident · Source and cause of the discharge · Types of material(s) discharged · Quantity of materials discharged · Danger or threat posed by the discharge · Number and types of injuries (if any) · Weather conditions at the incident location · Other information to help emergency personnel respond to the incident In the event of a spillage the following shall be contacted in chronological order: · Local fire authority: Emergency Hotline Use 911 or, Ben Warren (Deputy Chief, Fire Prevention) (413) 572-6303 · State agency: MassDEP's Emergency Response (24 Hour Spill/Emergency Line) 1-(888) 304-1133 · Federal agencies: National Response Center (800) 424-8802 or (202) 267-2675 TDD (202) 267-4477 (Only applicable if the presence of a visible sheen created by the discharged oil and/or sludge or emulsion deposited below the surface of the water may also be reportable. Otherwise, skip and move to Coast Guard.) United States Department of Homeland Security United States Coast Guard Atlantic Area, Boston Sector (617) 223-5757 · Local management: TBA – On-site Manager **Individual responsible for implementing MMP (Material Management Plan) and Long-Term Pollution Plan Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 34 · Remote management: Jim Lukaszewski Director of C-Store Operations Big Y Foods, Inc. Direct: 413-504-4442 Cell: 860-302-5338 4.6.3 Controlled Clean-up in Stormwater Apparatuses Small spills may be cleaned using the items found in the spill kits that are located on-site. If the spill extends beyond the PLBs, it is likely that stormwater infrastructure will capture contaminants. In the event of this situation, the proprietary separators / (Hydroworks HydroStorm© HS4i) will need to be cleaned immediately by a licensed liquid waste hauler. Accumulated oil, grease and sediment can be cleaned using a vacuum truck or other ordinary catch basin cleaning device. Cleaning must be completed by a licensed liquid waste hauler. Contaminated water or sediments removed from an oil grit separator shall be done in accordance with all applicable local, state and federal laws and regulations including M.G.L.c. 21C and 310 CMR 30.00. 4.6.4 Disposal of Waste Material Wastes to be contained in DOT steel 55-gallon drums. Drums to be properly labeled and stored in locked dumpster area until a hauler comes to remove them. Licensed waste hauler to remove drums from site and transport to licensed disposal facility. Waste disposal documents to be maintained in MMP binder. UST fills will be identified by color code per API standard. Proper labels to be affixed to waste disposal drums upon initial use and verified by weekly inspection. Oil Spill Response Trailers Activation & Deployment Standard Operating Procedure and Oil Spill Trailer Locations are located at the back of this plan. Materials kept in fixed quantities (absorbent socks, pillows and neoprene drain covers) will be replaced upon their use. Large quantity/bulk materials (granular absorbent, absorbent pads, personal protection equipment) to be inventoried weekly. 4.7 Record Keeping In accordance with federal regulations, the owner is responsible for maintaining the response plan at your facility, along with plan updates reflecting material changes. The owner is also responsible for keeping a log of response training drills and exercises. Records of inspections of response equipment must be kept for five years. Following any spills, the spill prevention and response plan should be evaluated for effectiveness and how it can be improved. 4.7.1 List of Significant (> 5 gallons) Spills and Leaks Document any significant spills or leaks and any response and correction measures taken. Call MassDEP's Emergency Response (24 Hour Spill/Emergency Line) 1-(888) 304-1133 for questions about pollution potential of spilled materials and proper disposal of spilled materials or wastes. (See Long- Term Pollution Plan – Spills and Leaks Table) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 35 4.7.2 Inspections Identify high-risk activities and critical areas of the facility that could pollute the aquifer and require regular or special inspection including: storage areas, loading areas, drains, containment areas, waste areas, and any other area of concern. The areas identified should be inspected for evidence of leaks/spills, integrity/condition, and maintenance and housekeeping. Inspection reports must be kept on file with the Plan. (See Long-Term Pollution Plan – Inspection Table) Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 36 Long-Term Pollution Plan Big Y Kiosk and Gas Station Redevelopment – 136 North King Street, Northampton, MA SPILLS AND LEAKS TABLE Spill logs to be maintained in MMP (Material Management Plan) Binder. Date Spill Leak Location Description Response Procedures Corrective Measures Taken (MM/DD/YY) (check one) Type of Material Quantity Source Reason Date Spill Leak Location Description Response Procedures Corrective Measures Taken (MM/DD/YY) (check one) Type of Material Quantity Source Reason Date Spill Leak Location Description Response Procedures Corrective Measures Taken (MM/DD/YY) (check one) Type of Material Quantity Source Reason Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 37 Long-Term Pollution Plan Big Y Kiosk and Gas Station Redevelopment – 136 North King Street, Northampton, MA INSPECTION TABLE Area to be Inspected Inspection Schedule Checked for leaks, conditions, maintenance Problems? If yes, describe action taken Date of Last Inspection Y N Dispensers Weekly Check for evidence of leaks Dispensing areas Daily Check for spills UST fill area Daily Check for spills Paved area and catch basins Daily Check for spills and inspect containment area of fill basins Drum Storage area Weekly Check containers for leaks and spills USTs Daily Review continuous monitoring system status Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 38 4.7.3 Site Plan The site plan shows storage area, shut-off and containment features, storm drain location, and direction of slopes. 5 ANNUAL OPERATION & MAINTENANCE BUDGET REQUIREMENT The responsible party, “Big Y”, agrees to maintain an adequate annual budget to provide for the routine maintenance activities detailed in this document including but not limited to:  Landscape Maintenance  Street Sweeping  Storm Water Management System Inspection & Maintenance  Snow Plowing & Removal INSPECTIONS Item/Condition to be Checked Annual Frequency Hourly Duration Total Hours Hourly Rate Item Subtotal Comments Proprietary Separators 2 0.5 1 $20 $20 Subsurface Structures 4 2 8 $20 $160 Landscaping / Trash Removal 2 2 4 $20 $80 Dispensers 52 0.5 26 $20 $520 Dispensing areas 365 0.25 91.25 $20 $1,825 UST fill area 365 0.25 91.25 $20 $1,825 Paved area and catch basins 365 0.25 91.25 $20 $1,825 Drum Storage area 52 0.25 13 $20 $260 USTs 365 0.25 91.25 $20 $1,825 INSPECTION SUB-TOTAL = $8,340 MAINTENANCE Stormwater Management System Long-Term Operation & Maintenance (O&M) Plan | 39 Proprietary Separators 2 (ea.) 0.5 1 $80 $80 * Cost to hire an external contractor Subsurface Structures 6 4 24 $20 $480 Landscaping / Mowing / Trash Removal 26 2 52 $50 $2,600 * Cost to hire an external contractor Snow Removal (seasonal) 75 0.5 37.5 $80 $3,000 * Cost to hire an external contractor Spill Kit 1 - - $500 $500 Reseeding Lawn 1 - - $1,020 $1,020 Replacing plantings 5 - - $300 $300 MAINTENANCE SUB-TOTAL = $7,980 INSPECTION & MAINTENANCE SUB-TOTAL = $16,320 CONTINGENCY = ± $816 5% of Sub-Total TOTAL = $17,136 Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix F APPENDIX F ILLICIT DISCHARGE COMPLIANCE STATEMENT Illicit Discharge Compliance Statement Site Stormwater Management System Site Redevelopment Big Y Kiosk and Gas Station 136 North King Street Northampton, MA Property Owner/ Responsible Party: Big Y 2145 Roosevelt Avenue PO Box 7850 Springfield, MA 01102 Storm Water Management System Owner: Big Y Site subject to Wetlands Protection Act: Not Applicable The above listed “responsible party” is responsible for implementation of this “Long-Term Operation and Maintenance Plan” and certifies that: · The site has been inspected for erosion and appropriate steps have been taken to permanently stabilize any eroded areas. · All aspects of storm water BMPs have been inspected for damage, wear and malfunction, and appropriate steps have been taken to repair or replace the system or portions of the system so that the stormwater at the site may be managed in accordance with: o The City of Northampton requirements o MA-DEP Stormwater Management Standards, revised January 2, 2008 · There is no record or knowledge of illicit discharges to the Site Stormwater Management System. · All “future property owners” must be notified of their continuing legal responsibility to operate and maintain the Site Stormwater Management System. · The “Long-Term Operation and Maintenance Plan” for the storm water BMPs is being implemented. Signature of Responsible Party: ______________________________ Big Y Big Y Kiosk and Gas Station | Stormwater Management Report | Appendix H APPENDIX G NOAA Rainfall Data